DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment beat-Vb and CG5597

DIOPT Version :9

Sequence 1:NP_001262511.1 Gene:beat-Vb / 41583 FlyBaseID:FBgn0038092 Length:328 Species:Drosophila melanogaster
Sequence 2:NP_611841.1 Gene:CG5597 / 37789 FlyBaseID:FBgn0034920 Length:260 Species:Drosophila melanogaster


Alignment Length:175 Identity:37/175 - (21%)
Similarity:75/175 - (42%) Gaps:19/175 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 LLQLGVHMLLVVRRIQCLRVTDINVPQIVDFRDN----VTLSCSYDI-SGHTLNSVKWYKNGKEF 66
            :|.:|    |:.|...|....|.:..:|:..::.    ..|.|.|:: ......:||||::.|..
  Fly     8 ILAIG----LLHRDALCYPTRDESEDKIIVLQNEEMEPTILDCDYEVEESPKFITVKWYRDDKSI 68

  Fly    67 FRYSPLTPPTYIP-FAVEGVQLIDDGNECNESSCRVELNLLGVKSSGVYRCEVSGDAPHFQLTAR 130
            :::...|||..|| |..|.....:...|.::....:.|....:.::|.|:|.|     ...|...
  Fly    69 YQWIFGTPPYAIPEFRNEIDSTYESSTEPSKQYSSLALINPTIATTGDYKCVV-----QTSLNTF 128

  Fly   131 DANMTVEALPQNNPLISSFHSTYRFNDFVEVNCSTDFSSLFTRIT 175
            .::..|:.:...|..:...|.|  .::..::||:.  ::::.|.|
  Fly   129 SSHQRVQVIDLRNYTLELSHKT--IHNETQLNCTV--TNVYPRPT 169

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
beat-VbNP_001262511.1 IG_like 39..121 CDD:214653 21/87 (24%)
Ig 41..130 CDD:143165 22/90 (24%)
CG5597NP_611841.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45451098
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21261
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.