DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment beat-Vb and beat-IIIb

DIOPT Version :9

Sequence 1:NP_001262511.1 Gene:beat-Vb / 41583 FlyBaseID:FBgn0038092 Length:328 Species:Drosophila melanogaster
Sequence 2:NP_788071.3 Gene:beat-IIIb / 35031 FlyBaseID:FBgn0053179 Length:404 Species:Drosophila melanogaster


Alignment Length:351 Identity:93/351 - (26%)
Similarity:152/351 - (43%) Gaps:77/351 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 RWLLQLGVHMLLVVR----RIQCLRVTDINVPQIVDFRDNVTLSCSYDISGHTLNSVKWYKNGKE 65
            |:.|..|...:|:::    .::||.:|:|.:|:.:...::..|.|.:|:.|.:|.||||||:|.|
  Fly     8 RYSLAYGALFILLLQLCFESVECLTMTEIKIPKHIMRHEDAVLGCKFDLDGESLYSVKWYKDGFE 72

  Fly    66 FFRYSPLTPPTYIPFAVEGVQLIDDGNECNESSCRVELNLLGVKSSGVYRCEVSGDAPHFQLTAR 130
            |:||.|...|....|.:.||    |....|.:...|.|..:.::|:|.|||||||:||.||..:.
  Fly    73 FYRYVPRDMPPGQVFPLPGV----DVELQNSTDVVVVLRSVSLQSTGRYRCEVSGEAPSFQTVSG 133

  Fly   131 DANMTVEALPQNNPLISSFHSTYRFNDFVEVNCSTDFSSLFTRITWYVNGIKVSLVDLLPSFETT 195
            ..:|.|...|::.|.|:.....|:..|.|.|||::..|.....::|.:||:..:. .||..:|..
  Fly   134 HEDMIVVVTPKHGPQITGGQPRYQIGDMVRVNCTSAASRPVCHLSWLINGMHANR-SLLRPYEPL 197

  Fly   196 IVAHGYSMRRIVSQLNFYANEPRFHQLQLQKLIQQKRTISPARLGLE--------------LRCV 246
            ||.                                :..:..||||||              |:||
  Fly   198 IVG--------------------------------REGLEVARLGLEFRVRGXHFKHGDMKLKCV 230

  Fly   247 AEI-----------------DRYPHLQREGTMFAQLFRDDIDQ---KNQKLINSRSGATPNSQVQ 291
            |:|                 .|.|.|:...|:.:: .|..:|:   ::::|..||..|...|...
  Fly   231 AKISSVYWQSNEESVESDKHQRIPVLESRETVMSK-SRQSMDKAQLEDKQLKKSRRPAAATSAAA 294

  Fly   292 HLLLVAISMTMTAVRLFTPLTFQYGA 317
            .....|.|.:.:...: .|....:|:
  Fly   295 AAAAAAASSSASRATV-APFGAMWGS 319

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
beat-VbNP_001262511.1 IG_like 39..121 CDD:214653 33/81 (41%)
Ig 41..130 CDD:143165 38/88 (43%)
beat-IIIbNP_788071.3 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45451103
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21261
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.