DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment beat-Vb and beat-Ib

DIOPT Version :9

Sequence 1:NP_001262511.1 Gene:beat-Vb / 41583 FlyBaseID:FBgn0038092 Length:328 Species:Drosophila melanogaster
Sequence 2:NP_001162987.1 Gene:beat-Ib / 34939 FlyBaseID:FBgn0028645 Length:327 Species:Drosophila melanogaster


Alignment Length:294 Identity:85/294 - (28%)
Similarity:128/294 - (43%) Gaps:65/294 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    24 LRVTDINVPQIVDFRDNVTLSCSYDISGHTLNSVKWYKNGKEFFRYSPLTPPTYIPFA------V 82
            ||..::.:|..|...||..|.|:|||...||.:||||:..:||:||:|...|.:..|.      |
  Fly    29 LRNVNVRIPSAVKRGDNALLICNYDIENDTLYTVKWYRGRREFYRYTPKENPAWKIFTKTNEIDV 93

  Fly    83 EGVQLIDDGNECNESSCRVELNLLGVKSSGVYRCEVSGDAPHFQLTARDANMTVEALPQNNPLIS 147
            |..|         .::..|.|..:....||.:.||||.|||.|..:...|:|.|..||...|:|:
  Fly    94 ETAQ---------SNASHVLLRNVPTSISGKFACEVSADAPTFDTSIVAADMEVVELPTQRPIIT 149

  Fly   148 SFHSTYRFNDFVEVNCSTDFSSLFTRITWYVNGIKV----------------SLVDLLPSFETTI 196
            ..||.||..|.:..|||:|:|.....:||::|.|:|                .|...:...:..:
  Fly   150 GIHSRYRLGDVINGNCSSDYSKPAANLTWWINDIQVPPNYLRIYDIQRHVAEHLESAVLEIKFVV 214

  Fly   197 VAHGYSMRRIVSQLNFYANEPRFHQLQLQ---KLIQQKRTISPARLGLELRCVA-----EIDRYP 253
            ..|.:    |.|:|....: .|.|::..|   |||::.|.          |.:|     :::.||
  Fly   215 TVHHF----IKSRLKLKCS-ARIHEIYAQESEKLIEEDRP----------RILASGRSPDMNMYP 264

  Fly   254 HLQREGTMFAQLFRDDIDQKNQK-LINSRSGATP 286
            ..|          ..|.|:.|:. ||:|.:...|
  Fly   265 FDQ----------PGDADEHNELFLIHSNAACGP 288

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
beat-VbNP_001262511.1 IG_like 39..121 CDD:214653 31/87 (36%)
Ig 41..130 CDD:143165 33/94 (35%)
beat-IbNP_001162987.1 Ig 160..>182 CDD:299845 7/21 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45451073
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21261
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.