DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10909 and NOP1

DIOPT Version :9

Sequence 1:NP_650236.1 Gene:CG10909 / 41581 FlyBaseID:FBgn0038090 Length:349 Species:Drosophila melanogaster
Sequence 2:NP_010270.1 Gene:NOP1 / 851548 SGDID:S000002172 Length:327 Species:Saccharomyces cerevisiae


Alignment Length:238 Identity:103/238 - (43%)
Similarity:144/238 - (60%) Gaps:10/238 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly   114 IEPHRHYGVYLLRNRFDAIQLLTRNTSSSADDYGERRVISE-------YREMRCEFRVWSPFQSK 171
            ||||||.|||:.|.:.|.  |:|:|.:.....|||:|:..|       ....:.|:|||:||:||
Yeast    88 IEPHRHAGVYIARGKEDL--LVTKNMAPGESVYGEKRISVEEPSKEDGVPPTKVEYRVWNPFRSK 150

  Fly   172 LAAGIMGGVSDLHLQIGSKVLYLGAGFGRSVSHISDIVGDSGMVYAVEQIPWAGRQLTIMANRRS 236
            ||||||||:.:|.:..|.|||||||..|.||||:||:||..|:|||||.....||:|..||.:|.
Yeast   151 LAAGIMGGLDELFIAPGKKVLYLGAASGTSVSHVSDVVGPEGVVYAVEFSHRPGRELISMAKKRP 215

  Fly   237 NIVPIVEDATMPYKYRYEVPACIDIIFADLPPSVLIRALMLNARHFLNPGGHFVAYLHSPTSQGV 301
            ||:||:|||..|.|||..: ..:|.:|||:......|.:.||:..||...|..|..:.:......
Yeast   216 NIIPIIEDARHPQKYRMLI-GMVDCVFADVAQPDQARIIALNSHMFLKDQGGVVISIKANCIDST 279

  Fly   302 VFNKDSFAAERRLLKEKQLEPKEMVLLEPFKAGYAFVVGVYIR 344
            |..:..||.|.:.|:|::::|.|.:.|||::..:..|||.|:|
Yeast   280 VDAETVFAREVQKLREERIKPLEQLTLEPYERDHCIVVGRYMR 322

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10909NP_650236.1 Fibrillarin 114..344 CDD:279593 102/236 (43%)
NOP1NP_010270.1 PTZ00146 85..320 CDD:240291 101/234 (43%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C157344772
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1889
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10335
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
54.800

Return to query results.
Submit another query.