DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10909 and AT5G52490

DIOPT Version :9

Sequence 1:NP_650236.1 Gene:CG10909 / 41581 FlyBaseID:FBgn0038090 Length:349 Species:Drosophila melanogaster
Sequence 2:NP_568773.1 Gene:AT5G52490 / 835325 AraportID:AT5G52490 Length:292 Species:Arabidopsis thaliana


Alignment Length:267 Identity:97/267 - (36%)
Similarity:146/267 - (54%) Gaps:13/267 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly    77 GGDSIQNDCQSECNVEDQGHEQEVTLETRIFSGTSDRIEPHRHYGVYLLRNRFDAIQLLTRNTSS 141
            ||:|.:.........|..|         .|..|:...:.||||.||::.:::.||  |:|:|...
plant    33 GGESGRGRGPGRVKSESDG---------GIKGGSKVLVTPHRHAGVFVAKSKADA--LVTKNLVP 86

  Fly   142 SADDYGERRVISEYRE-MRCEFRVWSPFQSKLAAGIMGGVSDLHLQIGSKVLYLGAGFGRSVSHI 205
            ....|.|:|:..:..: ...|:|||:|.:||||..|..||.::.::.|.|||||||..|.:|||:
plant    87 GEIIYNEKRIFVQNEDRSTVEYRVWNPHRSKLADAITTGVDNIWIKPGVKVLYLGASSGYTVSHV 151

  Fly   206 SDIVGDSGMVYAVEQIPWAGRQLTIMANRRSNIVPIVEDATMPYKYRYEVPACIDIIFADLPPSV 270
            |||||..|.|||||.....|:.|..||.:|:|::||:|||..|.|||..| ..:||||:|:....
plant   152 SDIVGPEGCVYAVEHSDICGKVLMNMAEKRTNVIPIIEDARHPAKYRMLV-GMVDIIFSDVNHPE 215

  Fly   271 LIRALMLNARHFLNPGGHFVAYLHSPTSQGVVFNKDSFAAERRLLKEKQLEPKEMVLLEPFKAGY 335
            ....|.|||.:||..||||:..:.:.:....:..:..:..|...|:.::|.|.|::.|:..:..:
plant   216 QANILSLNASYFLKSGGHFMISIKANSIDSTIAAETVYQMEVEKLQMEELRPTEILHLDSCEEKH 280

  Fly   336 AFVVGVY 342
            |.|.|.|
plant   281 ACVFGGY 287

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10909NP_650236.1 Fibrillarin 114..344 CDD:279593 90/230 (39%)
AT5G52490NP_568773.1 Fibrillarin 61..289 CDD:279593 90/230 (39%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1889
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1411035at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10335
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
54.880

Return to query results.
Submit another query.