DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10909 and FIB1

DIOPT Version :9

Sequence 1:NP_650236.1 Gene:CG10909 / 41581 FlyBaseID:FBgn0038090 Length:349 Species:Drosophila melanogaster
Sequence 2:NP_568772.3 Gene:FIB1 / 835323 AraportID:AT5G52470 Length:308 Species:Arabidopsis thaliana


Alignment Length:235 Identity:103/235 - (43%)
Similarity:149/235 - (63%) Gaps:4/235 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly   109 GTSDRIEPHRHYGVYLLRNRFDAIQLLTRNTSSSADDYGERRVISEYRE-MRCEFRVWSPFQSKL 172
            |:...:|||||.||::.:.:.||  |:|:|.......|.|:|:..:..: .:.|:|||:||:|||
plant    66 GSKVIVEPHRHAGVFIAKGKEDA--LVTKNLVPGEAVYNEKRISVQNEDGTKVEYRVWNPFRSKL 128

  Fly   173 AAGIMGGVSDLHLQIGSKVLYLGAGFGRSVSHISDIVGDSGMVYAVEQIPWAGRQLTIMANRRSN 237
            ||.|:|||.::.::.|:|||||||..|.:|||:||:||..|.|||||....:||.|..||.:|:|
plant   129 AAAILGGVDNIWIKPGAKVLYLGAASGTTVSHVSDLVGPEGCVYAVEFSHRSGRDLVNMAKKRTN 193

  Fly   238 IVPIVEDATMPYKYRYEVPACIDIIFADLPPSVLIRALMLNARHFLNPGGHFVAYLHSPTSQGVV 302
            ::||:|||..|.|||..| ..:|:||:|:......|.|.|||..||..|||||..:.:......|
plant   194 VIPIIEDARHPAKYRMLV-GMVDVIFSDVAQPDQARILALNASFFLKTGGHFVISIKANCIDSTV 257

  Fly   303 FNKDSFAAERRLLKEKQLEPKEMVLLEPFKAGYAFVVGVY 342
            ..:..|.:|.:.|:::|.:|.|.|.||||:..:|.|||.|
plant   258 AAEAVFQSEVKKLQQEQFKPAEQVTLEPFERDHACVVGGY 297

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10909NP_650236.1 Fibrillarin 114..344 CDD:279593 102/230 (44%)
FIB1NP_568772.3 PTZ00146 64..304 CDD:240291 103/235 (44%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1889
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1411035at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10335
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
54.880

Return to query results.
Submit another query.