DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10909 and fbl

DIOPT Version :9

Sequence 1:NP_650236.1 Gene:CG10909 / 41581 FlyBaseID:FBgn0038090 Length:349 Species:Drosophila melanogaster
Sequence 2:NP_998167.1 Gene:fbl / 406275 ZFINID:ZDB-GENE-040426-1936 Length:317 Species:Danio rerio


Alignment Length:234 Identity:102/234 - (43%)
Similarity:150/234 - (64%) Gaps:3/234 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly   109 GTSDRIEPHRHYGVYLLRNRFDAIQLLTRNTSSSADDYGERRVISEYREMRCEFRVWSPFQSKLA 173
            |....:|||||.||::.|.:.||  |:|:|.......|||:|:..|..|.:.|:|.|:||:||||
Zfish    79 GAKVTVEPHRHEGVFICRGKEDA--LVTKNMVIGESVYGEKRINVEEGETKIEYRAWNPFRSKLA 141

  Fly   174 AGIMGGVSDLHLQIGSKVLYLGAGFGRSVSHISDIVGDSGMVYAVEQIPWAGRQLTIMANRRSNI 238
            |.|:||:..:|::.|.||:||||..|.:|||:|||||..|:|||||....:||.|..:|.:|:||
Zfish   142 AAILGGIDQIHIKPGVKVMYLGAASGTTVSHVSDIVGPEGLVYAVEFSHRSGRDLLNVAKKRTNI 206

  Fly   239 VPIVEDATMPYKYRYEVPACIDIIFADLPPSVLIRALMLNARHFLNPGGHFVAYLHSPTSQGVVF 303
            :||:|||..|:|||..| ..:|:||||:......|.:.|||.:||..|||||..:.:........
Zfish   207 IPIIEDARHPHKYRMLV-GMVDVIFADVAQPDQTRIVALNAHNFLKNGGHFVISIKANCIDSTAA 270

  Fly   304 NKDSFAAERRLLKEKQLEPKEMVLLEPFKAGYAFVVGVY 342
            .:..||:|.:.:..:.::|:|.:.|||::..:|.|||:|
Zfish   271 PEAVFASEVKKMSAENMKPQEQLTLEPYERDHAVVVGIY 309

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10909NP_650236.1 Fibrillarin 114..344 CDD:279593 101/229 (44%)
fblNP_998167.1 PTZ00146 80..316 CDD:240291 101/233 (43%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170586791
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1889
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1411035at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10335
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
ZFIN 00.000 Not matched by this tool.
65.810

Return to query results.
Submit another query.