DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10909 and fbl

DIOPT Version :9

Sequence 1:NP_650236.1 Gene:CG10909 / 41581 FlyBaseID:FBgn0038090 Length:349 Species:Drosophila melanogaster
Sequence 2:NP_989101.1 Gene:fbl / 394705 XenbaseID:XB-GENE-970225 Length:325 Species:Xenopus tropicalis


Alignment Length:229 Identity:99/229 - (43%)
Similarity:153/229 - (66%) Gaps:3/229 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly   114 IEPHRHYGVYLLRNRFDAIQLLTRNTSSSADDYGERRVISEYREMRCEFRVWSPFQSKLAAGIMG 178
            :|||||.|:::.|.:.||  |:|:|.......|||:|:..|..|::.|:|.|:||:||:||.|:|
 Frog    92 VEPHRHEGIFICRGKEDA--LVTKNLVPGESVYGEKRISVEDGEVKTEYRAWNPFRSKIAAAILG 154

  Fly   179 GVSDLHLQIGSKVLYLGAGFGRSVSHISDIVGDSGMVYAVEQIPWAGRQLTIMANRRSNIVPIVE 243
            ||..:|::.|:|||||||..|.:|||:||:||..|:|||||....:||.|..:|.:|:||:|::|
 Frog   155 GVDQIHIKPGAKVLYLGAASGTTVSHVSDVVGPEGLVYAVEFSHRSGRDLINVAKKRTNIIPVIE 219

  Fly   244 DATMPYKYRYEVPACIDIIFADLPPSVLIRALMLNARHFLNPGGHFVAYLHSPTSQGVVFNKDSF 308
            ||..|:|||..| ..:|::|||:......|.:.|||.:||..|||||..:.:.........:..|
 Frog   220 DARHPHKYRMLV-GMVDVVFADVAQPDQTRIVALNAHNFLKNGGHFVISIKANCIDSTAAPEAVF 283

  Fly   309 AAERRLLKEKQLEPKEMVLLEPFKAGYAFVVGVY 342
            |||.:.::::.::|:|.:.|||::..:|.|||:|
 Frog   284 AAEVKKMQQENMKPQEQLTLEPYERDHAVVVGIY 317

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10909NP_650236.1 Fibrillarin 114..344 CDD:279593 99/229 (43%)
fblNP_989101.1 PTZ00146 89..324 CDD:240291 99/229 (43%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1411035at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10335
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
33.110

Return to query results.
Submit another query.