DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10909 and Fib

DIOPT Version :9

Sequence 1:NP_650236.1 Gene:CG10909 / 41581 FlyBaseID:FBgn0038090 Length:349 Species:Drosophila melanogaster
Sequence 2:NP_523817.1 Gene:Fib / 37662 FlyBaseID:FBgn0003062 Length:344 Species:Drosophila melanogaster


Alignment Length:234 Identity:109/234 - (46%)
Similarity:154/234 - (65%) Gaps:3/234 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly   109 GTSDRIEPHRHYGVYLLRNRFDAIQLLTRNTSSSADDYGERRVISEYREMRCEFRVWSPFQSKLA 173
            |.:..||||||.||::.|.:.||  |:|||....::.|||:|:..|....:.|:|||:||:||||
  Fly   108 GKTVTIEPHRHEGVFIARGKEDA--LVTRNFVPGSEVYGEKRISVETNGEKIEYRVWNPFRSKLA 170

  Fly   174 AGIMGGVSDLHLQIGSKVLYLGAGFGRSVSHISDIVGDSGMVYAVEQIPWAGRQLTIMANRRSNI 238
            |.::|||..:|:..|||||||||..|.:|||:||:||..|:|||||....:||.|..:|.:|:||
  Fly   171 AAVLGGVEQIHMPPGSKVLYLGAASGTTVSHVSDVVGPEGLVYAVEFSHRSGRDLINVAKKRTNI 235

  Fly   239 VPIVEDATMPYKYRYEVPACIDIIFADLPPSVLIRALMLNARHFLNPGGHFVAYLHSPTSQGVVF 303
            :||:|||..|:|||..| ..:|.||||:......|.:.|||:|||..|||||..:.:........
  Fly   236 IPIIEDARHPHKYRMLV-GMVDTIFADVAQPDQGRIVALNAQHFLKNGGHFVISIKASCIDSTAQ 299

  Fly   304 NKDSFAAERRLLKEKQLEPKEMVLLEPFKAGYAFVVGVY 342
            .:..||||.:.::..:|:|:|.:.|||::..:|.|||||
  Fly   300 PEAVFAAEVKKMQADKLKPQEQLTLEPYERDHAVVVGVY 338

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10909NP_650236.1 Fibrillarin 114..344 CDD:279593 108/229 (47%)
FibNP_523817.1 PTZ00146 109..344 CDD:240291 108/233 (46%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45456829
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1889
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1411035at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR10335
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
54.850

Return to query results.
Submit another query.