DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10909 and Fbll1

DIOPT Version :9

Sequence 1:NP_650236.1 Gene:CG10909 / 41581 FlyBaseID:FBgn0038090 Length:349 Species:Drosophila melanogaster
Sequence 2:NP_001102294.1 Gene:Fbll1 / 363563 RGDID:1562841 Length:324 Species:Rattus norvegicus


Alignment Length:235 Identity:105/235 - (44%)
Similarity:151/235 - (64%) Gaps:5/235 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly   109 GTSDRIEPHRHYGVYLLRNRFDAIQLLTRNTSSSADDYGERRV-ISEYREMRCEFRVWSPFQSKL 172
            |.:..:|||||.||::.|...||  |:|.|.......|||:|| ::|..|.: |:|.|:||:|||
  Rat    85 GITVSVEPHRHEGVFIYRGAEDA--LVTLNMVPGVSVYGEKRVTVTENGEKQ-EYRTWNPFRSKL 146

  Fly   173 AAGIMGGVSDLHLQIGSKVLYLGAGFGRSVSHISDIVGDSGMVYAVEQIPWAGRQLTIMANRRSN 237
            ||.|:|||..:|::..||||||||..|.:|||:|||:|..|:|||||....|||.|..:|.:|:|
  Rat   147 AAAILGGVDQIHIKPKSKVLYLGAASGTTVSHVSDIIGPDGLVYAVEFSHRAGRDLVNVAKKRTN 211

  Fly   238 IVPIVEDATMPYKYRYEVPACIDIIFADLPPSVLIRALMLNARHFLNPGGHFVAYLHSPTSQGVV 302
            |:|::|||..|.|||..: ..:|:||||:......|.:.|||..||..||||:..:.:.......
  Rat   212 IIPVLEDARHPLKYRMLI-GMVDVIFADVAQPDQSRIVALNAHTFLRNGGHFLISIKANCIDSTA 275

  Fly   303 FNKDSFAAERRLLKEKQLEPKEMVLLEPFKAGYAFVVGVY 342
            ..:..||:|.:.|:::.|:|:|.:.|||::..:|.|||||
  Rat   276 SAEAVFASEVKKLQQENLKPQEQLTLEPYERDHAVVVGVY 315

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10909NP_650236.1 Fibrillarin 114..344 CDD:279593 104/230 (45%)
Fbll1NP_001102294.1 PTZ00146 81..321 CDD:240291 105/235 (45%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166345796
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1889
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1411035at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10335
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
76.810

Return to query results.
Submit another query.