DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10909 and FBLL1

DIOPT Version :9

Sequence 1:NP_650236.1 Gene:CG10909 / 41581 FlyBaseID:FBgn0038090 Length:349 Species:Drosophila melanogaster
Sequence 2:NP_001342203.1 Gene:FBLL1 / 345630 HGNCID:35458 Length:334 Species:Homo sapiens


Alignment Length:229 Identity:104/229 - (45%)
Similarity:146/229 - (63%) Gaps:3/229 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly   114 IEPHRHYGVYLLRNRFDAIQLLTRNTSSSADDYGERRVISEYREMRCEFRVWSPFQSKLAAGIMG 178
            :|||||.||::.|...||  |:|.|.......||||||......::.|:|.|:||:|||||.|:|
Human   100 VEPHRHEGVFIYRGAEDA--LVTLNMVPGQSVYGERRVTVTEGGVKQEYRTWNPFRSKLAAAILG 162

  Fly   179 GVSDLHLQIGSKVLYLGAGFGRSVSHISDIVGDSGMVYAVEQIPWAGRQLTIMANRRSNIVPIVE 243
            ||..:|::..||||||||..|.:|||:|||:|..|:|||||....|||.|..:|.:|:||:|::|
Human   163 GVDQIHIKPKSKVLYLGAASGTTVSHVSDIIGPDGLVYAVEFSHRAGRDLVNVAKKRTNIIPVLE 227

  Fly   244 DATMPYKYRYEVPACIDIIFADLPPSVLIRALMLNARHFLNPGGHFVAYLHSPTSQGVVFNKDSF 308
            ||..|.|||..: ..:|:||||:......|.:.|||..||..||||:..:.:.........:..|
Human   228 DARHPLKYRMLI-GMVDVIFADVAQPDQSRIVALNAHTFLRNGGHFLISIKANCIDSTASAEAVF 291

  Fly   309 AAERRLLKEKQLEPKEMVLLEPFKAGYAFVVGVY 342
            |:|.|.|:::.|:|:|.:.|||::..:|.|||||
Human   292 ASEVRKLQQENLKPQEQLTLEPYERDHAVVVGVY 325

Known Domains:


Indicated by green bases in alignment.

Software error:

Illegal division by zero at /www/www.flyrnai.org/docroot/cgi-bin/DRSC_prot_align.pl line 591.

For help, please send mail to the webmaster (ritg@hms.harvard.edu), giving this error message and the time and date of the error.

GeneSequenceDomainRegion External IDIdentity
CG10909NP_650236.1 Fibrillarin 114..344 CDD:279593 104/229 (45%)
FBLL1NP_001342203.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..97
PTZ00146 90..331 CDD:240291 104/229 (45%)