DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10909 and fib1

DIOPT Version :9

Sequence 1:NP_650236.1 Gene:CG10909 / 41581 FlyBaseID:FBgn0038090 Length:349 Species:Drosophila melanogaster
Sequence 2:NP_596229.1 Gene:fib1 / 2540479 PomBaseID:SPBC2D10.10c Length:305 Species:Schizosaccharomyces pombe


Alignment Length:237 Identity:99/237 - (41%)
Similarity:150/237 - (63%) Gaps:14/237 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly   114 IEPHRHYGVYLLRNRFDAIQLLTRNTSSSADDYGERRV-ISEYREMRCEFRVWSPFQSKLAAGIM 177
            ||||||.||::.|.:.|.  |:|||.......|.|:|: :......:.|:|||:||:|||||||:
pombe    75 IEPHRHAGVFIARGKEDL--LVTRNLVPGESVYNEKRISVDSPDGTKVEYRVWNPFRSKLAAGIL 137

  Fly   178 GGVSDLHLQIGSKVLYLGAGFGRSVSHISDIVGDSGMVYAVEQIPWAGRQLTIMANRRSNIVPIV 242
            ||:.:::::.|::||||||..|.||||::|:||..|:|||||....:||.|..||.:|:|::|||
pombe   138 GGLDNIYIKPGARVLYLGAANGTSVSHVADVVGPEGLVYAVEFSHRSGRDLLNMAKKRTNVIPIV 202

  Fly   243 EDATMPYKYRYEVPACIDIIFADLPPSVLIRALMLNARHFL-NPGGHFVAY----LHSPTSQGVV 302
            |||....|||..| ..:|::|||:......|.:.|||..|| |.||..::.    :.|.....||
pombe   203 EDARHVQKYRMLV-GMVDVVFADVAQPDQARIVALNAAAFLKNEGGVVISVKASCIDSTADAAVV 266

  Fly   303 FNKDSFAAERRLLKEKQLEPKEMVLLEPFKAGYAFVVGVYIR 344
                 ||.|.:.::|::::|:|.:.|||::..:..:||.|:|
pombe   267 -----FAREVKKMQEEKIKPQEQLTLEPYERDHCIIVGKYLR 303

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10909NP_650236.1 Fibrillarin 114..344 CDD:279593 98/235 (42%)
fib1NP_596229.1 PTZ00146 71..301 CDD:240291 97/233 (42%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1889
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10335
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
43.870

Return to query results.
Submit another query.