DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10909 and FBL

DIOPT Version :9

Sequence 1:NP_650236.1 Gene:CG10909 / 41581 FlyBaseID:FBgn0038090 Length:349 Species:Drosophila melanogaster
Sequence 2:NP_001427.2 Gene:FBL / 2091 HGNCID:3599 Length:321 Species:Homo sapiens


Alignment Length:235 Identity:104/235 - (44%)
Similarity:154/235 - (65%) Gaps:3/235 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly   108 SGTSDRIEPHRHYGVYLLRNRFDAIQLLTRNTSSSADDYGERRVISEYREMRCEFRVWSPFQSKL 172
            ||.:..:|||||.||::.|.:.||  |:|:|.......|||:||.....:.:.|:|.|:||:|||
Human    82 SGKNVMVEPHRHEGVFICRGKEDA--LVTKNLVPGESVYGEKRVSISEGDDKIEYRAWNPFRSKL 144

  Fly   173 AAGIMGGVSDLHLQIGSKVLYLGAGFGRSVSHISDIVGDSGMVYAVEQIPWAGRQLTIMANRRSN 237
            ||.|:|||..:|::.|:|||||||..|.:|||:|||||..|:|||||....:||.|..:|.:|:|
Human   145 AAAILGGVDQIHIKPGAKVLYLGAASGTTVSHVSDIVGPDGLVYAVEFSHRSGRDLINLAKKRTN 209

  Fly   238 IVPIVEDATMPYKYRYEVPACIDIIFADLPPSVLIRALMLNARHFLNPGGHFVAYLHSPTSQGVV 302
            |:|::|||..|:|||..: |.:|:||||:......|.:.|||..||..|||||..:.:.......
Human   210 IIPVIEDARHPHKYRMLI-AMVDVIFADVAQPDQTRIVALNAHTFLRNGGHFVISIKANCIDSTA 273

  Fly   303 FNKDSFAAERRLLKEKQLEPKEMVLLEPFKAGYAFVVGVY 342
            ..:..||:|.:.::::.::|:|.:.|||::..:|.|||||
Human   274 SAEAVFASEVKKMQQENMKPQEQLTLEPYERDHAVVVGVY 313

Known Domains:


Indicated by green bases in alignment.

Software error:

Illegal division by zero at /www/www.flyrnai.org/docroot/cgi-bin/DRSC_prot_align.pl line 591.

For help, please send mail to the webmaster (ritg@hms.harvard.edu), giving this error message and the time and date of the error.

GeneSequenceDomainRegion External IDIdentity
CG10909NP_650236.1 Fibrillarin 114..344 CDD:279593 102/229 (45%)
FBLNP_001427.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..87 2/4 (50%)
PTZ00146 82..320 CDD:240291 104/235 (44%)