DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10909 and fib-1

DIOPT Version :9

Sequence 1:NP_650236.1 Gene:CG10909 / 41581 FlyBaseID:FBgn0038090 Length:349 Species:Drosophila melanogaster
Sequence 2:NP_506691.1 Gene:fib-1 / 179999 WormBaseID:WBGene00001423 Length:352 Species:Caenorhabditis elegans


Alignment Length:229 Identity:102/229 - (44%)
Similarity:144/229 - (62%) Gaps:3/229 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly   114 IEPHRHYGVYLLRNRFDAIQLLTRNTSSSADDYGERRVISEYREMRCEFRVWSPFQSKLAAGIMG 178
            :||||..||::::.:.||  |.|:|.......|||:||..:......|:|||:||:|||||.|||
 Worm   119 VEPHRLGGVFIVKGKEDA--LATKNMVVGESVYGEKRVSVDDGAGSIEYRVWNPFRSKLAASIMG 181

  Fly   179 GVSDLHLQIGSKVLYLGAGFGRSVSHISDIVGDSGMVYAVEQIPWAGRQLTIMANRRSNIVPIVE 243
            |:.:.|::.|:|:|||||..|.:|||.||:||..|:|||||....:||.|..:|.:|.|:|||||
 Worm   182 GLENTHIKPGTKLLYLGAASGTTVSHCSDVVGPEGIVYAVEFSHRSGRDLLGVAKKRPNVVPIVE 246

  Fly   244 DATMPYKYRYEVPACIDIIFADLPPSVLIRALMLNARHFLNPGGHFVAYLHSPTSQGVVFNKDSF 308
            ||..|:|||..| ..:|:||:|:......|.:.|||::||..|||.|..:.:.........:..|
 Worm   247 DARHPHKYRMLV-GMVDVIFSDVAQPDQARIVALNAQNFLRNGGHAVISIKANCIDSTAEPEAVF 310

  Fly   309 AAERRLLKEKQLEPKEMVLLEPFKAGYAFVVGVY 342
            |.|...|||::.:|.|.|.|||::..:|.||.||
 Worm   311 AGEVNKLKEEKFKPLEQVTLEPYERDHAVVVAVY 344

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10909NP_650236.1 Fibrillarin 114..344 CDD:279593 102/229 (45%)
fib-1NP_506691.1 PTZ00146 115..351 CDD:240291 102/229 (45%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160162439
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1889
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1411035at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10335
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
65.850

Return to query results.
Submit another query.