DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10909 and C06E1.9

DIOPT Version :9

Sequence 1:NP_650236.1 Gene:CG10909 / 41581 FlyBaseID:FBgn0038090 Length:349 Species:Drosophila melanogaster
Sequence 2:NP_498894.1 Gene:C06E1.9 / 176206 WormBaseID:WBGene00015524 Length:643 Species:Caenorhabditis elegans


Alignment Length:330 Identity:66/330 - (20%)
Similarity:114/330 - (34%) Gaps:107/330 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly    32 KITSKNFENPTKETSIQSPIKN-----------SIKPSWNPEPKITRTSIWDIESAGGDSIQNDC 85
            |..|..|...:.:||.:|..:|           .::..|...|...:.|:.|:.|...|      
 Worm    54 KSDSFRFSAISSKTSWESAHRNLLENLTKTVPVLLENGWKKSPDFQKNSLIDLFSLLED------ 112

  Fly    86 QSECNVEDQGHEQEVTLETRIFSGTSDRIEPHRHYGVYLLRNRFDAIQLLTRNTSSSADDYGERR 150
                  ||.....::|.|:|  |.|.|.:|.:    ..:...:||  :|||         ||..:
 Worm   113 ------EDATRIFKMTQESR--SITEDDVEDY----FSMFDKKFD--RLLT---------YGAPQ 154

  Fly   151 VISEYREMRCEFRVWSPFQSKLAAGIMGGVSDLHLQIGSKVLYLGAGFGRSVSHISDIVGDSGMV 215
            ..:..|:        ||.:.|.|        :|.:::   ::.:||.. ::...|:|.:....| 
 Worm   155 FENCVRD--------SPMRQKYA--------NLCVEV---LVAVGASV-KNAQKITDFLEKQSM- 198

  Fly   216 YAVEQIPWAGRQLTIMANRRSNIVPIVEDATMPYKY--RYEVPACID------------------ 260
             .|.:| |..|           |..|.|..|..|.|  .::|...:|                  
 Worm   199 -KVSKI-WMTR-----------IPEIFEKITNFYDYPMMFDVAMALDGFPLRKVFLARRFALQSI 250

  Fly   261 -IIFADLPPSVLIRALMLNARHFLNPGGHFVAY--------LHSPTSQGVVFNKDSFAAERRLLK 316
             .:|.::.|:...: :....|..|.....||.|        |.|..|..:|   .|....:.:|:
 Worm   251 LEVFIEMAPNTKYK-VRERVRQELEKASRFVGYASEMGHDNLLSSFSPKIV---SSIEDSKHILE 311

  Fly   317 EKQLE 321
            .:.:|
 Worm   312 VETIE 316

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10909NP_650236.1 Fibrillarin 114..344 CDD:279593 45/237 (19%)
C06E1.9NP_498894.1 CUE_ASCC2 336..373 CDD:270547
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10335
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.