DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10909 and AgaP_AGAP011244

DIOPT Version :9

Sequence 1:NP_650236.1 Gene:CG10909 / 41581 FlyBaseID:FBgn0038090 Length:349 Species:Drosophila melanogaster
Sequence 2:XP_309401.4 Gene:AgaP_AGAP011244 / 1270682 VectorBaseID:AGAP011244 Length:320 Species:Anopheles gambiae


Alignment Length:234 Identity:108/234 - (46%)
Similarity:153/234 - (65%) Gaps:3/234 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly   109 GTSDRIEPHRHYGVYLLRNRFDAIQLLTRNTSSSADDYGERRVISEYREMRCEFRVWSPFQSKLA 173
            |.|..||||||.|:::.|.:.||  |:|.|....::.|||:|:..|....:.|:|||:||:||||
Mosquito    82 GKSVVIEPHRHEGIFIARGKEDA--LVTLNLVPGSEVYGEKRISVENEGDKKEYRVWNPFRSKLA 144

  Fly   174 AGIMGGVSDLHLQIGSKVLYLGAGFGRSVSHISDIVGDSGMVYAVEQIPWAGRQLTIMANRRSNI 238
            |.::|||..:|:..|||||||||..|.:|||:|||||..|:|||||....:||.|..:|.:|:||
Mosquito   145 AAVLGGVDKIHMPPGSKVLYLGAASGTTVSHVSDIVGPEGLVYAVEFSHRSGRDLLNVAKKRTNI 209

  Fly   239 VPIVEDATMPYKYRYEVPACIDIIFADLPPSVLIRALMLNARHFLNPGGHFVAYLHSPTSQGVVF 303
            :||:|||..|:|||..| ..:|.:|||:......|.:.|||.:||..|||||..:.:........
Mosquito   210 IPIIEDARHPHKYRMLV-GMVDTVFADVAQPDQARIVALNAHNFLKNGGHFVISIKASCIDSTAV 273

  Fly   304 NKDSFAAERRLLKEKQLEPKEMVLLEPFKAGYAFVVGVY 342
            .:..||||.:.|:.::|:|:|.:.|||::..:|.|||||
Mosquito   274 PEAVFAAEVKKLQSEKLKPQEQITLEPYERDHAVVVGVY 312

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10909NP_650236.1 Fibrillarin 114..344 CDD:279593 106/229 (46%)
AgaP_AGAP011244XP_309401.4 PTZ00146 83..319 CDD:240291 107/233 (46%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1889
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1411035at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10335
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
54.880

Return to query results.
Submit another query.