DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10909 and hectd1

DIOPT Version :9

Sequence 1:NP_650236.1 Gene:CG10909 / 41581 FlyBaseID:FBgn0038090 Length:349 Species:Drosophila melanogaster
Sequence 2:XP_012823549.1 Gene:hectd1 / 100192372 XenbaseID:XB-GENE-1010869 Length:2580 Species:Xenopus tropicalis


Alignment Length:129 Identity:32/129 - (24%)
Similarity:52/129 - (40%) Gaps:22/129 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    33 ITSKNFENPTKETSIQSPIKNSIKPSWNPEPKITRTSIWDIES----AGGDSIQNDCQ---SECN 90
            :.|..:...|.:...:..:..|:.|......|||...:..||.    |.| ::.:.|:   |:|.
 Frog  1979 VASDPYSARTPQEDGEDMLLFSVPPEEFTSKKITTKIVQQIEEPLALASG-ALPDWCEQLTSKCP 2042

  Fly    91 VEDQGHEQEVTLETRIFSGTSDRIEPHRHYGVYLLRNRFDAIQLLTRNTSSSA---DDYGERRV 151
            .       .:..|||....|.......|  .:..|:||.:|  .:.|:.::||   ||.||.||
 Frog  2043 F-------LIPFETRQLYFTCTAFGASR--AIVWLQNRREA--TVERSRTASAVRRDDPGEFRV 2095

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10909NP_650236.1 Fibrillarin 114..344 CDD:279593 14/41 (34%)
hectd1XP_012823549.1 Ank_2 366..457 CDD:372319
ANK repeat 366..393 CDD:293786
PLN03192 <386..612 CDD:215625
ANK repeat 396..426 CDD:293786
ANK repeat 428..457 CDD:293786
F5_F8_type_C 1130..1263 CDD:390053
MIB_HERC2 1300..1358 CDD:369043
BTHB 1861..1927 CDD:375836
HECTc 2101..2578 CDD:238033
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165170892
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.