DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment d-cup and CBL7

DIOPT Version :10

Sequence 1:NP_650235.1 Gene:d-cup / 41580 FlyBaseID:FBgn0038089 Length:219 Species:Drosophila melanogaster
Sequence 2:NP_194386.1 Gene:CBL7 / 828763 AraportID:AT4G26560 Length:214 Species:Arabidopsis thaliana


Alignment Length:114 Identity:27/114 - (23%)
Similarity:56/114 - (49%) Gaps:17/114 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    97 EFVNYMTIL-MSRDMERKMEFAYMVYDKNGMG-INR----EIISSSVERFFVGDDDEVLEMRLDM 155
            ||...:::. .|..::.|::.::.:||....| |.|    :::.:::....:...||::|   .:
plant    94 EFARALSVFHPSAPIDDKIDLSFQLYDLKQQGFIERQGVKQLVVATLAASGMSQSDEIVE---SI 155

  Fly   156 VDFLLLKFDEDQDGYISFEEYRSIVLQQPRL-----LEFLGPI---FPS 196
            :|...::.|...:|.|..||:..:|.:.|.|     |::|..|   |||
plant   156 IDKTFVQADTKHEGMIDEEEWMDLVFRHPLLLKNMTLQYLKDITTTFPS 204

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
d-cupNP_650235.1 FRQ1 70..182 CDD:444056 19/90 (21%)
CBL7NP_194386.1 FRQ1 <76..180 CDD:444056 18/88 (20%)

Return to query results.
Submit another query.