DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment d-cup and tescb

DIOPT Version :10

Sequence 1:NP_650235.1 Gene:d-cup / 41580 FlyBaseID:FBgn0038089 Length:219 Species:Drosophila melanogaster
Sequence 2:NP_991256.1 Gene:tescb / 402993 ZFINID:ZDB-GENE-040426-1903 Length:216 Species:Danio rerio


Alignment Length:69 Identity:19/69 - (27%)
Similarity:28/69 - (40%) Gaps:21/69 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly   150 EMRLDMVDFLLLKFDEDQDGYISFEEYRSIV-----------------LQQPRLLEF----LGPI 193
            |:|...:.||....|.|.||.|:.||||.:|                 :....:||.    :||:
Zfish   111 EIRRAKLRFLFNMHDTDNDGTITLEEYRHVVEELLSRSGALGRETAKGIADAAMLEVASITVGPM 175

  Fly   194 FPSD 197
            .|.:
Zfish   176 APDE 179

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
d-cupNP_650235.1 FRQ1 70..182 CDD:444056 14/48 (29%)
tescbNP_991256.1 FRQ1 30..>144 CDD:444056 14/32 (44%)

Return to query results.
Submit another query.