DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment d-cup and KCNIP1

DIOPT Version :10

Sequence 1:NP_650235.1 Gene:d-cup / 41580 FlyBaseID:FBgn0038089 Length:219 Species:Drosophila melanogaster
Sequence 2:NP_001265268.1 Gene:KCNIP1 / 30820 HGNCID:15521 Length:241 Species:Homo sapiens


Alignment Length:98 Identity:22/98 - (22%)
Similarity:42/98 - (42%) Gaps:30/98 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly    97 EFVNYMTILMSRDMERKMEFAYMVYDKNGMG-INREIISSSVERFFVGDDDEVLEMRLDM----- 155
            :||..::||:...:..|:.:.:.:||.|..| ||:|.:...|:..:            ||     
Human   135 DFVTALSILLRGTVHEKLRWTFNLYDINKDGYINKEEMMDIVKAIY------------DMMGKYT 187

  Fly   156 ------------VDFLLLKFDEDQDGYISFEEY 176
                        ||....|.|:::||.::.:|:
Human   188 YPVLKEDTPRQHVDVFFQKMDKNKDGIVTLDEF 220

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
d-cupNP_650235.1 FRQ1 70..182 CDD:444056 22/98 (22%)
KCNIP1NP_001265268.1 FRQ1 <115..226 CDD:444056 22/98 (22%)

Return to query results.
Submit another query.