DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment d-cup and KCNIP2

DIOPT Version :10

Sequence 1:NP_650235.1 Gene:d-cup / 41580 FlyBaseID:FBgn0038089 Length:219 Species:Drosophila melanogaster
Sequence 2:NP_055406.2 Gene:KCNIP2 / 30819 HGNCID:15522 Length:285 Species:Homo sapiens


Alignment Length:99 Identity:17/99 - (17%)
Similarity:43/99 - (43%) Gaps:32/99 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly    97 EFVNYMTILMSRDMERKMEFAYMVYD--KNGMGINREIISSSVERFFVGDDDEVLEMRLDM---- 155
            :||..:::::...::.::.:|:.:||  |:|.....|::             ::::...||    
Human   179 DFVAGLSVILRGTVDDRLNWAFNLYDLNKDGCITKEEML-------------DIMKSIYDMMGKY 230

  Fly   156 -------------VDFLLLKFDEDQDGYISFEEY 176
                         |:....|.|.::||.::.||:
Human   231 TYPALREEAPREHVESFFQKMDRNKDGVVTIEEF 264

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
d-cupNP_650235.1 FRQ1 70..182 CDD:444056 17/99 (17%)
KCNIP2NP_055406.2 EF-hand_8 134..184 CDD:404678 2/4 (50%)
FRQ1 <163..270 CDD:444056 17/99 (17%)

Return to query results.
Submit another query.