DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment CG10126 and MYLK3

DIOPT Version :9

Sequence 1:	NP_788664.2	Gene:	CG10126 / 41579	FlyBaseID:	FBgn0038088	Length:	227	Species:	Drosophila melanogaster
Sequence 2:	NP_872299.2	Gene:	MYLK3 / 91807	HGNCID:	29826	Length:	819	Species:	Homo sapiens

Alignment Length:	120	Identity:	28/120 - (23%)
Similarity:	46/120 - (38%)	Gaps:	31/120 - (25%)

- Green bases have known domain annotations that are detailed below.

  Fly    87 RDTGLDVSEEEIKQMFATFDEDGSGSINMTEFLLKLRPPMPQSRLNIIDQAFNKMDRDEDGVITI 151
            :.|||.::.:.||...|...||....||:...|         |.:|:| |.::..:......:.:
Human   535 KSTGLPLAAKIIKVKSAKDREDVKNEINIMNQL---------SHVNLI-QLYDAFESKHSCTLVM 589

  Fly   152 QDLKNVYSVKEHPKYQSGEKSEDEILTDFLHNFEGGRGNLDGKI-TRE--EFVNY 203
            :             |..|.:..|.|..:..|..|     ||..: ||:  |.|:|
Human   590 E-------------YVDGGELFDRITDEKYHLTE-----LDVVLFTRQICEGVHY 626

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
CG10126	NP_788664.2	EF-hand_7	62..119	CDD:290234	10/31 (32%)
		EFh	64..119	CDD:238008	10/31 (32%)
		EFh	97..154	CDD:238008	12/56 (21%)
		EF-hand_7	98..158	CDD:290234	12/59 (20%)
		EF-hand_7	134..204	CDD:290234	15/73 (21%)
MYLK3	NP_872299.2	Disordered. /evidence=ECO:0000256\|SAM:MobiDB-lite	146..334
		Disordered. /evidence=ECO:0000256\|SAM:MobiDB-lite	347..462
		STKc_MLCK3	510..770	CDD:271094	28/120 (23%)
		S_TKc	513..770	CDD:214567	28/120 (23%)
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	0	0.000	Not matched by this tool.
eggNOG	1	0.900	-	-		E1_KOG0032
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
Isobase	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	0	0.000	Not matched by this tool.
RoundUp	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
User_Submission	0	0.000	Not matched by this tool.
	1	0.900