DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10126 and TDA1

DIOPT Version :9

Sequence 1:NP_788664.2 Gene:CG10126 / 41579 FlyBaseID:FBgn0038088 Length:227 Species:Drosophila melanogaster
Sequence 2:NP_014019.1 Gene:TDA1 / 855336 SGDID:S000004905 Length:586 Species:Saccharomyces cerevisiae


Alignment Length:138 Identity:32/138 - (23%)
Similarity:51/138 - (36%) Gaps:49/138 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly    78 NEEEFITGIRDT-GLDVSEEEIKQMFATFD-----EDG-------SGSI--NMTEFLLKLRPP-- 125
            :.|..:..|||| ...:|...:|.. .|||     ::|       ||.:  |.| |:|..:||  
Yeast   432 SRERSLNRIRDTLKKTLSMTSLKPA-GTFDYLHANKNGTSLSSSKSGLVKKNST-FVLDPKPPKN 494

  Fly   126 ---------MPQSRLNIIDQAFNKMDRDEDGVITIQDLKNVYSVKEH---------PKYQSGEKS 172
                     .|:||.|     ||...       |:....:..|||::         |:..|...:
Yeast   495 SLMNGCFSTTPESRSN-----FNTPK-------TLSRQGSSTSVKKYVNEVDLLLTPRTASMSSN 547

  Fly   173 EDEILTDF 180
            :...:.|:
Yeast   548 DTTAINDY 555

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10126NP_788664.2 EF-hand_7 62..119 CDD:290234 15/55 (27%)
EFh 64..119 CDD:238008 15/55 (27%)
EFh 97..154 CDD:238008 20/81 (25%)
EF-hand_7 98..158 CDD:290234 20/84 (24%)
EF-hand_7 134..204 CDD:290234 9/56 (16%)
TDA1NP_014019.1 STKc_CAMK 37..350 CDD:270687
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0032
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.