DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10126 and MEK1

DIOPT Version :9

Sequence 1:NP_788664.2 Gene:CG10126 / 41579 FlyBaseID:FBgn0038088 Length:227 Species:Drosophila melanogaster
Sequence 2:NP_014996.3 Gene:MEK1 / 854533 SGDID:S000005878 Length:497 Species:Saccharomyces cerevisiae


Alignment Length:179 Identity:36/179 - (20%)
Similarity:58/179 - (32%) Gaps:81/179 - (45%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 RTKGWSLKNPNCDLYTLEANMASQALRELTDGEDKDPITKLRLLCLSRGATGILGLGRAFRAMDD 71
            |.|.:.||  :||:.            ||:.|.:::.|.|.||:               |...||
Yeast   104 RDKTYLLK--HCDVI------------ELSQGSEENDIKKTRLV---------------FMINDD 139

  Fly    72 DGS----KALNEEEFITGIRDTGLDVSEEEIKQMFATFDEDGSGSI------------------- 113
            ..|    |.|::..|:.       :|.:.||.....     |:|:.                   
Yeast   140 LQSSLDPKLLDQMGFLR-------EVDQWEITNRIV-----GNGTFGHVLITHNSKERDEDVCYH 192

  Fly   114 --NMTEFLLKLRPPMPQSRLNIIDQAFNKMDRDEDGVITIQDLKNVYSV 160
              |....::||:|              ||.|: |..::...|..|:..|
Yeast   193 PENYAVKIIKLKP--------------NKFDK-EARILLRLDHPNIIKV 226

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10126NP_788664.2 EF-hand_7 62..119 CDD:290234 13/81 (16%)
EFh 64..119 CDD:238008 13/79 (16%)
EFh 97..154 CDD:238008 12/77 (16%)
EF-hand_7 98..158 CDD:290234 13/80 (16%)
EF-hand_7 134..204 CDD:290234 7/27 (26%)
MEK1NP_014996.3 FHA 28..122 CDD:238017 8/31 (26%)
STKc_CAMK 160..443 CDD:270687 15/87 (17%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0032
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.