DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10126 and RCK1

DIOPT Version :9

Sequence 1:NP_788664.2 Gene:CG10126 / 41579 FlyBaseID:FBgn0038088 Length:227 Species:Drosophila melanogaster
Sequence 2:NP_011357.1 Gene:RCK1 / 852719 SGDID:S000003126 Length:512 Species:Saccharomyces cerevisiae


Alignment Length:286 Identity:56/286 - (19%)
Similarity:87/286 - (30%) Gaps:117/286 - (40%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 SLKNPNCDLYTL---EANMASQALRELTDGEDKDPITKLRLLCLSRG---------ATGI----- 59
            |..||:|..:..   .||........:|.||..|.|  ::|.|.|..         |..|     
Yeast   190 SKNNPHCTKFIAFQESANYYYLVTELVTGGEIFDRI--VQLTCFSEDLARHVITQVAIAIKHMHY 252

  Fly    60 LGLGR-------------AFRAMDDDGSKALNEEEFITGIRDTGLDVSEEEIKQMFATFDEDGSG 111
            :|:..             .|..:|.|..|   |:||..|:...|:                   |
Yeast   253 MGIVHRDVKPENLLFEPIPFYGLDGDMQK---EDEFTLGVGGGGI-------------------G 295

  Fly   112 SINMTEFLL--KLRPPMPQSRLNIIDQAFNKMDRDEDGVITIQDLKNVYSVKEH----------- 163
            .:.:.:|.|  |||....::....|:...::       |.|    ...||:|..           
Yeast   296 LVKLMDFGLAKKLRNNTAKTPCGTIEYVASE-------VFT----SKRYSMKVDMWSIGCVLFTL 349

  Fly   164 -----PKYQSGEKS--------EDEILTDFLHNFEGGRGNL---------DGKITREEFV----- 201
                 |.|:..||:        :.|.|..:..|...|..|.         :.:...::|:     
Yeast   350 LCGYPPFYEKNEKTLLKKISRGDYEFLAPWWDNISSGAKNAVTHLLEVDPNKRYDIDDFLNDPWL 414

  Fly   202 -----------NYYATISASIDNDMF 216
                       |.||::. ||.||.|
Yeast   415 NSYDCLKDSNSNSYASVQ-SILNDSF 439

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10126NP_788664.2 EF-hand_7 62..119 CDD:290234 10/69 (14%)
EFh 64..119 CDD:238008 10/67 (15%)
EFh 97..154 CDD:238008 9/58 (16%)
EF-hand_7 98..158 CDD:290234 9/61 (15%)
EF-hand_7 134..204 CDD:290234 17/118 (14%)
RCK1NP_011357.1 STKc_RCK1-like 119..414 CDD:270998 48/258 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0032
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.