DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10126 and RCK2

DIOPT Version :9

Sequence 1:NP_788664.2 Gene:CG10126 / 41579 FlyBaseID:FBgn0038088 Length:227 Species:Drosophila melanogaster
Sequence 2:NP_013349.1 Gene:RCK2 / 850950 SGDID:S000004238 Length:610 Species:Saccharomyces cerevisiae


Alignment Length:182 Identity:38/182 - (20%)
Similarity:68/182 - (37%) Gaps:51/182 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly    75 KALNEE-EFITGIRD--TGLDVSEEEIKQM----------FATFDEDGSGSI-----------NM 115
            ::|:|: |.|:.|:|  |..|..|:||.:.          :...::.|.|:.           :.
Yeast   123 ESLSEQSEIISDIQDDSTDDDNMEDEIPEKSFLEQKELIGYKLINKIGEGAFSKVFRAIPAKNSS 187

  Fly   116 TEFLLKLRPPMPQSRLNIIDQAFNKMDRDEDGVITIQDLKNVYSVKEHPKYQSGE-----KSEDE 175
            .|||.|....:   .:.:|.:|               ||.::..  :|.|...|:     .|.|:
Yeast   188 NEFLTKNYKAV---AIKVIKKA---------------DLSSING--DHRKKDKGKDSTKTSSRDQ 232

  Fly   176 ILTDF-LH-NFEGGRGNLDGKITREEFVNYYATISASIDNDMFFDLMMRRAY 225
            :|.:. || ....|...:...|..:|..:||..|...:.....|..::|..|
Yeast   233 VLKEVALHKTVSAGCSQIVAFIDFQETDSYYYIIQELLTGGEIFGEIVRLTY 284

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10126NP_788664.2 EF-hand_7 62..119 CDD:290234 14/67 (21%)
EFh 64..119 CDD:238008 14/67 (21%)
EFh 97..154 CDD:238008 10/77 (13%)
EF-hand_7 98..158 CDD:290234 11/80 (14%)
EF-hand_7 134..204 CDD:290234 15/76 (20%)
RCK2NP_013349.1 STKc_RCK1-like 161..478 CDD:270998 27/144 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0032
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.