DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10126 and CAPS2

DIOPT Version :9

Sequence 1:NP_788664.2 Gene:CG10126 / 41579 FlyBaseID:FBgn0038088 Length:227 Species:Drosophila melanogaster
Sequence 2:XP_006719711.2 Gene:CAPS2 / 84698 HGNCID:16471 Length:614 Species:Homo sapiens


Alignment Length:217 Identity:55/217 - (25%)
Similarity:113/217 - (52%) Gaps:18/217 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 SLKNPNC----DLYTLEAN--MASQALRELTDGEDKDPITKLRLLCLSRGATGILGLGRAFRAMD 70
            |||..:.    |:...|.|  :..:|::::.    |:.:.|       ||...:.|||:.|:.:|
Human   405 SLKTASMEQEDDIIIQETNDRLVFKAIQDVL----KEKLHK-------RGVRILTGLGKYFQQLD 458

  Fly    71 DDGSKALNEEEFITGIRDTGLDVSEEEIKQMFATFDEDGSGSINMTEFLLKLRPPMPQSRLNIID 135
            .:|:..|::.:|...::...|:|||::.:..:...:::|:|.::..||...:...|.:.|.:.:.
Human   459 KEGNGLLDKADFKQALKVFHLEVSEKDFESAWLILNDNGNGKVDYGEFKRGIIGEMNEYRKSYVR 523

  Fly   136 QAFNKMDRDEDGVITIQDLKNVYSVKEHPKYQSGEKSEDEILTDFLHNFEGGRGNLDGKITREEF 200
            :||.|:|.::.|.:.|.:::..|..|:|.:..||..:|:||.:.||...:......| :::..||
Human   524 KAFMKLDFNKSGSVPIINIRKCYCAKKHSQVISGHSTEEEIKSSFLETLKVACSKSD-EVSYGEF 587

  Fly   201 VNYYATISASIDNDMFFDLMMR 222
            .:||..:|..|.:|..|..::|
Human   588 EDYYEGLSIGIVDDEDFVNILR 609

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10126NP_788664.2 EF-hand_7 62..119 CDD:290234 14/56 (25%)
EFh 64..119 CDD:238008 12/54 (22%)
EFh 97..154 CDD:238008 12/56 (21%)
EF-hand_7 98..158 CDD:290234 12/59 (20%)
EF-hand_7 134..204 CDD:290234 19/69 (28%)
CAPS2XP_006719711.2 YajQ_like <408..>444 CDD:294471 7/46 (15%)
EF-hand_7 450..510 CDD:290234 15/59 (25%)
EFh 454..510 CDD:238008 13/55 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0032
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0 Normalized mean entropy S8196
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.760

Return to query results.
Submit another query.