Sequence 1: | NP_788664.2 | Gene: | CG10126 / 41579 | FlyBaseID: | FBgn0038088 | Length: | 227 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_974150.2 | Gene: | CPK29 / 843936 | AraportID: | AT1G76040 | Length: | 561 | Species: | Arabidopsis thaliana |
Alignment Length: | 201 | Identity: | 64/201 - (31%) |
---|---|---|---|
Similarity: | 93/201 - (46%) | Gaps: | 43/201 - (21%) |
- Green bases have known domain annotations that are detailed below.
Fly 28 ASQALRE--LTDGEDKD-PI--------------TKLRLLCLSRGATG-----ILGLGRAFRAMD 70
Fly 71 DDGSKALNEEEFITGIRDTGLDVSEEEIKQMFATFDEDGSGSINMTEFLLKLRPPMPQSRL---- 131
Fly 132 NIIDQAFNKMDRDEDGVITIQDLKNVYSVKEHPKYQSGEKSE-DEILTDFLHNFEGGRGNLDGKI 195
Fly 196 TREEFV 201 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CG10126 | NP_788664.2 | EF-hand_7 | 62..119 | CDD:290234 | 20/56 (36%) |
EFh | 64..119 | CDD:238008 | 19/54 (35%) | ||
EFh | 97..154 | CDD:238008 | 23/60 (38%) | ||
EF-hand_7 | 98..158 | CDD:290234 | 24/63 (38%) | ||
EF-hand_7 | 134..204 | CDD:290234 | 24/69 (35%) | ||
CPK29 | NP_974150.2 | S_TKc | 112..370 | CDD:214567 | 3/8 (38%) |
STKc_CAMK | 112..369 | CDD:270687 | 3/7 (43%) | ||
PTZ00184 | 405..548 | CDD:185504 | 52/157 (33%) | ||
EFh | 417..476 | CDD:238008 | 21/61 (34%) | ||
EFh | 489..549 | CDD:238008 | 24/70 (34%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_KOG0032 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
2 | 1.810 |