DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10126 and CPK29

DIOPT Version :9

Sequence 1:NP_788664.2 Gene:CG10126 / 41579 FlyBaseID:FBgn0038088 Length:227 Species:Drosophila melanogaster
Sequence 2:NP_974150.2 Gene:CPK29 / 843936 AraportID:AT1G76040 Length:561 Species:Arabidopsis thaliana


Alignment Length:201 Identity:64/201 - (31%)
Similarity:93/201 - (46%) Gaps:43/201 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    28 ASQALRE--LTDGEDKD-PI--------------TKLRLLCLSRGATG-----ILGLGRAFRAMD 70
            |::||..  :||.:..| ||              .||:.|.|...|..     |.||.:.|:.||
plant   361 AAEALEHPWMTDTKISDKPINSAVLVRMKQFRAMNKLKKLALKVIAENLSEEEIKGLKQTFKNMD 425

  Fly    71 DDGSKALNEEEFITGIRDTGLDVSEEEIKQMFATFDEDGSGSINMTEFLLKLRPPMPQSRL---- 131
            .|.|..:..:|...|:...|..::|.||||:....|.|.||:|:..||   :...|.:.||    
plant   426 TDESGTITFDELRNGLHRLGSKLTESEIKQLMEAADVDKSGTIDYIEF---VTATMHRHRLEKEE 487

  Fly   132 NIIDQAFNKMDRDEDGVITIQDLKNVYSVKEHPKYQSGEKSE-DEILTDFLHNFEGGRGNLDGKI 195
            |:| :||...|:|..|.||..:||  :|:.|   |..|:.:. ||::.|.       ..:.||:|
plant   488 NLI-EAFKYFDKDRSGFITRDELK--HSMTE---YGMGDDATIDEVINDV-------DTDNDGRI 539

  Fly   196 TREEFV 201
            ..||||
plant   540 NYEEFV 545

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10126NP_788664.2 EF-hand_7 62..119 CDD:290234 20/56 (36%)
EFh 64..119 CDD:238008 19/54 (35%)
EFh 97..154 CDD:238008 23/60 (38%)
EF-hand_7 98..158 CDD:290234 24/63 (38%)
EF-hand_7 134..204 CDD:290234 24/69 (35%)
CPK29NP_974150.2 S_TKc 112..370 CDD:214567 3/8 (38%)
STKc_CAMK 112..369 CDD:270687 3/7 (43%)
PTZ00184 405..548 CDD:185504 52/157 (33%)
EFh 417..476 CDD:238008 21/61 (34%)
EFh 489..549 CDD:238008 24/70 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0032
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.