DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10126 and CPK30

DIOPT Version :9

Sequence 1:NP_788664.2 Gene:CG10126 / 41579 FlyBaseID:FBgn0038088 Length:227 Species:Drosophila melanogaster
Sequence 2:NP_177612.2 Gene:CPK30 / 843813 AraportID:AT1G74740 Length:541 Species:Arabidopsis thaliana


Alignment Length:198 Identity:44/198 - (22%)
Similarity:78/198 - (39%) Gaps:35/198 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    14 KNPNCDL----------YTLEANMASQALRELTDGEDKDPITKLRLLCLSRGATGILGLGRAFRA 68
            |.||..|          :::...:..:|||.:.:......:..:|               ..|..
plant   322 KAPNVPLGDIVRSRLKQFSMMNRLKKKALRVIAEHLSIQEVEVIR---------------NMFTL 371

  Fly    69 MDDDGSKALNEEEFITGIRDTGLDVSEEEIKQMFATFDEDGSGSINMTEFLLKLRPPMPQSRLNI 133
            ||||....::..|...|:|..|..:.|.|||.:....|.:|:|.::..||:..:...........
plant   372 MDDDNDGKISYLELRAGLRKVGSQLGEPEIKLLMEVADVNGNGCLDYGEFVAVIIHLQKMENDEH 436

  Fly   134 IDQAFNKMDRDEDGVITIQDLKNVYSVKEHPKYQSGEKSEDEILTDFLHNFEGGRGNLDGKITRE 198
            ..|||...|:|..|.|..::|:...:      .:.|| .::.::.|.:...:..:   ||||..:
plant   437 FRQAFMFFDKDGSGYIESEELREALT------DELGE-PDNSVIIDIMREVDTDK---DGKINYD 491

  Fly   199 EFV 201
            |||
plant   492 EFV 494

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10126NP_788664.2 EF-hand_7 62..119 CDD:290234 17/56 (30%)
EFh 64..119 CDD:238008 17/54 (31%)
EFh 97..154 CDD:238008 15/56 (27%)
EF-hand_7 98..158 CDD:290234 15/59 (25%)
EF-hand_7 134..204 CDD:290234 18/68 (26%)
CPK30NP_177612.2 STKc_CAMK 58..316 CDD:270687
PTZ00184 353..497 CDD:185504 37/167 (22%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0032
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.