Sequence 1: | NP_788664.2 | Gene: | CG10126 / 41579 | FlyBaseID: | FBgn0038088 | Length: | 227 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_176386.2 | Gene: | CPK19 / 842490 | AraportID: | AT1G61950 | Length: | 551 | Species: | Arabidopsis thaliana |
Alignment Length: | 198 | Identity: | 53/198 - (26%) |
---|---|---|---|
Similarity: | 86/198 - (43%) | Gaps: | 31/198 - (15%) |
- Green bases have known domain annotations that are detailed below.
Fly 32 LRELTDGEDKDPI--------------TKLRLLCLSRGATG-----ILGLGRAFRAMDDDGSKAL 77
Fly 78 NEEEFITGIRDTGLDVSEEEIKQMFATFDEDGSGSINMTEFLLKLRPPMPQSRLNIIDQAFNKMD 142
Fly 143 RDEDGVITIQDLKNVYSVKEHPKYQSGEKSEDEILTDFLHNFEGGRGNLDGKITREEFVNYYATI 207
Fly 208 SAS 210 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CG10126 | NP_788664.2 | EF-hand_7 | 62..119 | CDD:290234 | 19/56 (34%) |
EFh | 64..119 | CDD:238008 | 18/54 (33%) | ||
EFh | 97..154 | CDD:238008 | 18/56 (32%) | ||
EF-hand_7 | 98..158 | CDD:290234 | 18/59 (31%) | ||
EF-hand_7 | 134..204 | CDD:290234 | 19/69 (28%) | ||
CPK19 | NP_176386.2 | STKc_CAMK | 97..356 | CDD:270687 | |
Pkinase | 98..357 | CDD:278497 | 53/198 (27%) | ||
PTZ00184 | 393..538 | CDD:185504 | 42/155 (27%) | ||
EFh | 405..464 | CDD:238008 | 20/58 (34%) | ||
EFh | 477..537 | CDD:238008 | 19/70 (27%) | ||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_KOG0032 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
2 | 1.810 |