DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10126 and CPK19

DIOPT Version :9

Sequence 1:NP_788664.2 Gene:CG10126 / 41579 FlyBaseID:FBgn0038088 Length:227 Species:Drosophila melanogaster
Sequence 2:NP_176386.2 Gene:CPK19 / 842490 AraportID:AT1G61950 Length:551 Species:Arabidopsis thaliana


Alignment Length:198 Identity:53/198 - (26%)
Similarity:86/198 - (43%) Gaps:31/198 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    32 LRELTDGEDKDPI--------------TKLRLLCLSRGATG-----ILGLGRAFRAMDDDGSKAL 77
            :||..:..|| ||              .||:.|.....|..     :.||...|..||.|.|..:
plant   357 IREGGEASDK-PIDSAVLSRMKQLRAMNKLKKLAFKFIAQNLKEEELKGLKTMFANMDTDKSGTI 420

  Fly    78 NEEEFITGIRDTGLDVSEEEIKQMFATFDEDGSGSINMTEFLLKLRPPMPQSRLNIIDQAFNKMD 142
            ..:|..:|:...|..::|.|:||:....|.||:|:|:..||:..........|.:.:.:||...|
plant   421 TYDELKSGLEKLGSRLTETEVKQLLEDADVDGNGTIDYIEFISATMNRFRVEREDNLFKAFQHFD 485

  Fly   143 RDEDGVITIQDLKNVYSVKEHPKYQSGEKSEDEILTDFLHNFEGGRGNLDGKITREEFVNYYATI 207
            :|..|.|:.|:|:.  ::||   |..|   :|.::.:.:...:...   ||.|..:||.|...:.
plant   486 KDNSGFISRQELET--AMKE---YNMG---DDIMIKEIISEVDADN---DGSINYQEFCNMMKSC 539

  Fly   208 SAS 210
            |.|
plant   540 SQS 542

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10126NP_788664.2 EF-hand_7 62..119 CDD:290234 19/56 (34%)
EFh 64..119 CDD:238008 18/54 (33%)
EFh 97..154 CDD:238008 18/56 (32%)
EF-hand_7 98..158 CDD:290234 18/59 (31%)
EF-hand_7 134..204 CDD:290234 19/69 (28%)
CPK19NP_176386.2 STKc_CAMK 97..356 CDD:270687
Pkinase 98..357 CDD:278497 53/198 (27%)
PTZ00184 393..538 CDD:185504 42/155 (27%)
EFh 405..464 CDD:238008 20/58 (34%)
EFh 477..537 CDD:238008 19/70 (27%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0032
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.