DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10126 and AT1G49580

DIOPT Version :9

Sequence 1:NP_788664.2 Gene:CG10126 / 41579 FlyBaseID:FBgn0038088 Length:227 Species:Drosophila melanogaster
Sequence 2:NP_175381.1 Gene:AT1G49580 / 841382 AraportID:AT1G49580 Length:606 Species:Arabidopsis thaliana


Alignment Length:158 Identity:32/158 - (20%)
Similarity:64/158 - (40%) Gaps:34/158 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    21 YTLEANMASQALRELTDGEDKDPI--TKLRLLCLSRGATGILGLGRAFRAMDDDGSKALNEE--- 80
            |...:::...|||.|:....||.|  .|.:...|:....|::.:.....|:..:.::|:.|.   
plant   434 YLRSSSLRKAALRALSKTLIKDEILYLKTQFSLLAPNKDGLITMDTIRMALASNATEAMKESRIP 498

  Fly    81 EF---ITGIRDTGLDVS------------------EEEIKQMFATFDEDGSGSINMTEFL--LKL 122
            ||   :.|::..|:|..                  |:.|:..:..||::|:.:|.:.|..  |.:
plant   499 EFLALLNGLQYRGMDFEEFCAAAINVHQHESLDCWEQSIRHAYELFDKNGNRAIVIEELASELGV 563

  Fly   123 RPPMPQSRLNIIDQAFNKMDRDEDGVIT 150
            .|.:|      :....:...|..||.::
plant   564 GPSIP------VHSVLHDWIRHTDGKLS 585

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10126NP_788664.2 EF-hand_7 62..119 CDD:290234 15/80 (19%)
EFh 64..119 CDD:238008 15/78 (19%)
EFh 97..154 CDD:238008 12/56 (21%)
EF-hand_7 98..158 CDD:290234 12/55 (22%)
EF-hand_7 134..204 CDD:290234 3/17 (18%)
AT1G49580NP_175381.1 S_TKc 151..412 CDD:214567
STKc_CAMK 151..411 CDD:270687
FRQ1 452..592 CDD:227455 27/140 (19%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0032
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.