| Sequence 1: | NP_788664.2 | Gene: | CG10126 / 41579 | FlyBaseID: | FBgn0038088 | Length: | 227 | Species: | Drosophila melanogaster |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | XP_038944566.1 | Gene: | Kalrn / 84009 | RGDID: | 621865 | Length: | 2989 | Species: | Rattus norvegicus |
| Alignment Length: | 207 | Identity: | 37/207 - (17%) |
|---|---|---|---|
| Similarity: | 74/207 - (35%) | Gaps: | 39/207 - (18%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 17 NCDL--YTLE-----ANMASQALRELTDG----EDKDPITKLRLLCLSRGATGILGLGRAFRAMD 70
Fly 71 DDGSKALNEEEFITGIRDTGLDVS-EEEIKQMFATFDEDGSGSINMTEFLLKLRPPMPQSRLNII 134
Fly 135 DQAFNKMDRDEDGVITIQDLKNVYSVKEHPKYQSG-------EKSEDEILTDFLHNFEGGRGNLD 192
Fly 193 GKITREEFVNYY 204 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| CG10126 | NP_788664.2 | EF-hand_7 | 62..119 | CDD:290234 | 8/57 (14%) |
| EFh | 64..119 | CDD:238008 | 8/55 (15%) | ||
| EFh | 97..154 | CDD:238008 | 5/56 (9%) | ||
| EF-hand_7 | 98..158 | CDD:290234 | 6/59 (10%) | ||
| EF-hand_7 | 134..204 | CDD:290234 | 16/76 (21%) | ||
| Kalrn | XP_038944566.1 | SEC14 | 42..180 | CDD:214706 | |
| SPEC | 193..413 | CDD:238103 | |||
| SPEC | 314..539 | CDD:238103 | |||
| SPEC | 540..769 | CDD:238103 | |||
| SPEC | 894..1132 | CDD:238103 | |||
| SPEC | 1138..1238 | CDD:197544 | |||
| RhoGEF | 1287..1457 | CDD:238091 | |||
| PH1_Kalirin_Trio_like | 1464..1586 | CDD:270060 | |||
| SH3_Kalirin_1 | 1652..1711 | CDD:212786 | |||
| SH3-RhoG_link | 1708..1892 | CDD:406906 | |||
| RhoGEF | 1935..2104 | CDD:395496 | |||
| PH2_Kalirin_Trio_p63RhoGEF | 2109..2243 | CDD:270061 | |||
| SH3_Kalirin_2 | 2327..2385 | CDD:212787 | |||
| Ig strand A | 2466..2469 | CDD:409353 | |||
| I-set | 2474..2568 | CDD:400151 | |||
| Ig strand A' | 2482..2485 | CDD:409353 | |||
| Ig strand B | 2491..2498 | CDD:409353 | |||
| Ig strand C | 2504..2512 | CDD:409353 | |||
| Ig strand C' | 2515..2517 | CDD:409353 | |||
| Ig strand D | 2523..2532 | CDD:409353 | |||
| Ig strand E | 2534..2538 | CDD:409353 | |||
| Ig strand F | 2547..2555 | CDD:409353 | |||
| Ig strand G | 2558..2568 | CDD:409353 | |||
| FN3 | 2572..2663 | CDD:238020 | 13/70 (19%) | ||
| STKc_Kalirin_C | 2693..2940 | CDD:271017 | 19/104 (18%) | ||
| Blue background indicates that the domain is not in the aligned region. | |||||
| Tool | Simple Score | Weighted Score | Original Tool Information | |||
|---|---|---|---|---|---|---|
| BLAST Result | Score | Score Type | Cluster ID | |||
| Compara | 0 | 0.000 | Not matched by this tool. | |||
| Domainoid | 0 | 0.000 | Not matched by this tool. | |||
| eggNOG | 1 | 0.900 | - | - | E1_KOG0032 | |
| Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
| Homologene | 0 | 0.000 | Not matched by this tool. | |||
| Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
| OMA | 0 | 0.000 | Not matched by this tool. | |||
| OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
| OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
| OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
| orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
| Panther | 0 | 0.000 | Not matched by this tool. | |||
| Phylome | 0 | 0.000 | Not matched by this tool. | |||
| SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
| SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
| TreeFam | 0 | 0.000 | Not matched by this tool. | |||
| 1 | 0.900 | |||||