DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment CG10126 and PPCK1

DIOPT Version :9

Sequence 1:	NP_788664.2	Gene:	CG10126 / 41579	FlyBaseID:	FBgn0038088	Length:	227	Species:	Drosophila melanogaster
Sequence 2:	NP_172341.1	Gene:	PPCK1 / 837387	AraportID:	AT1G08650	Length:	284	Species:	Arabidopsis thaliana

Alignment Length:	47	Identity:	9/47 - (19%)
Similarity:	21/47 - (44%)	Gaps:	3/47 - (6%)

- Green bases have known domain annotations that are detailed below.

  Fly   134 IDQAFNKMDRDEDGVITIQDLKNVYSVKE---HPKYQSGEKSEDEIL 177
            |.:..:.|.:|....:..:|....:|.::   ||..|...::|:..:
plant   238 IFRGVSSMAKDFLRKLICKDASRRFSAEQALRHPWIQRAGETEERFI 284

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
CG10126	NP_788664.2	EF-hand_7	62..119	CDD:290234
		EFh	64..119	CDD:238008
		EFh	97..154	CDD:238008	3/19 (16%)
		EF-hand_7	98..158	CDD:290234	4/23 (17%)
		EF-hand_7	134..204	CDD:290234	9/47 (19%)
PPCK1	NP_172341.1	STKc_CAMK	14..272	CDD:270687	6/33 (18%)
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Domainoid	0	0.000	Not matched by this tool.
eggNOG	1	0.900	-	-		E1_KOG0032
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
	1	0.900