DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10126 and CPK28

DIOPT Version :9

Sequence 1:NP_788664.2 Gene:CG10126 / 41579 FlyBaseID:FBgn0038088 Length:227 Species:Drosophila melanogaster
Sequence 2:NP_201422.1 Gene:CPK28 / 836753 AraportID:AT5G66210 Length:523 Species:Arabidopsis thaliana


Alignment Length:208 Identity:47/208 - (22%)
Similarity:73/208 - (35%) Gaps:80/208 - (38%)


- Green bases have known domain annotations that are detailed below.


  Fly    31 ALRELTDGEDKDPITKLRLLCLSRGATGILGLGRAFRAMDDDGSKALNEEEFITGI-RDTGLDVS 94
            |||.|....|:..|:.||               ..|.|:|.|.:..::.||....: :|....:.
plant   354 ALRALASTLDEAEISDLR---------------DQFDAIDVDKNGVISLEEMRQALAKDLPWKLK 403

  Fly    95 EEEIKQMFATFDEDGSGSINMTEFLL----------------KLRPPMPQSRLNIIDQAFNKMDR 143
            :..:.::....|.:..|.::.|||:.                :||     ||     .||.|.|.
plant   404 DSRVAEILEAIDSNTDGLVDFTEFVAAALHVHQLEEHDSEKWQLR-----SR-----AAFEKFDL 458

  Fly   144 DEDGVITIQDLKNVYSVKEHPKYQSGEKSEDEILTDFLHNFEGGRGNL-----------DGKITR 197
            |:||.||.::|:                         :|.  |.||::           ||||:.
plant   459 DKDGYITPEELR-------------------------MHT--GLRGSIDPLLDEADIDRDGKISL 496

  Fly   198 EEFVNYYATISAS 210
            .||.....|.|.|
plant   497 HEFRRLLRTASIS 509

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10126NP_788664.2 EF-hand_7 62..119 CDD:290234 11/57 (19%)
EFh 64..119 CDD:238008 11/55 (20%)
EFh 97..154 CDD:238008 18/72 (25%)
EF-hand_7 98..158 CDD:290234 19/75 (25%)
EF-hand_7 134..204 CDD:290234 20/80 (25%)
CPK28NP_201422.1 STKc_CAMK 61..321 CDD:270687
FRQ1 346..502 CDD:227455 44/199 (22%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0032
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.