DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10126 and AT5G24430

DIOPT Version :9

Sequence 1:NP_788664.2 Gene:CG10126 / 41579 FlyBaseID:FBgn0038088 Length:227 Species:Drosophila melanogaster
Sequence 2:NP_197831.3 Gene:AT5G24430 / 832514 AraportID:AT5G24430 Length:594 Species:Arabidopsis thaliana


Alignment Length:165 Identity:34/165 - (20%)
Similarity:59/165 - (35%) Gaps:64/165 - (38%)


- Green bases have known domain annotations that are detailed below.


  Fly    65 AFRAMDDDGSKALNEEEFITGIRDTGLDVSEEEIKQMFATFD-EDGSGSIN-----MTEF----- 118
            |.:|:    |||:.:||.:.             :|..|...| :||..|:|     :|.:     
plant   435 ALKAL----SKAIPDEELVF-------------LKAQFMLLDPKDGGLSLNCFTMALTRYATDAM 482

  Fly   119 -------LLKLRPPMPQSRLN----------------------IIDQAFNKMDRDEDGVITIQDL 154
                   :|....|:.|.:|:                      |...||...:.:.:.:|::|:|
plant   483 MESRLPDILNTMQPLAQKKLDFEEFCAAAVSVYQLEALEEWEQIATSAFEHFEHEGNRIISVQEL 547

  Fly   155 KNVYSV--KEHPKYQSGEKSEDEILT-----DFLH 182
            ....||  ..:|..:...:|.|..|:     .|||
plant   548 AGEMSVGPSAYPLLKDWIRSSDGKLSFLGYAKFLH 582

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10126NP_788664.2 EF-hand_7 62..119 CDD:290234 15/71 (21%)
EFh 64..119 CDD:238008 15/71 (21%)
EFh 97..154 CDD:238008 17/96 (18%)
EF-hand_7 98..158 CDD:290234 18/99 (18%)
EF-hand_7 134..204 CDD:290234 14/56 (25%)
AT5G24430NP_197831.3 STKc_CAMK 142..404 CDD:270687
S_TKc 143..405 CDD:214567
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0032
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.