Sequence 1: | NP_788664.2 | Gene: | CG10126 / 41579 | FlyBaseID: | FBgn0038088 | Length: | 227 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_197446.1 | Gene: | CDPK19 / 832065 | AraportID: | AT5G19450 | Length: | 533 | Species: | Arabidopsis thaliana |
Alignment Length: | 204 | Identity: | 44/204 - (21%) |
---|---|---|---|
Similarity: | 90/204 - (44%) | Gaps: | 27/204 - (13%) |
- Green bases have known domain annotations that are detailed below.
Fly 14 KNPNCDL-YTLEANMASQALRELTDGEDKDPITKLRLLCLSRGATGILGLGRAFRAMDDDGSKAL 77
Fly 78 NEEEFITGIRDTG-LDVSEEEIKQMFATFDEDGSGSINMTEFL---LKLRPPMPQSRLNIIDQAF 138
Fly 139 NKMDRDEDGVITIQDLKNVYSVKEHPKYQSGEKSEDEILTDFLHNFEGGRGNLDGKITREEFVNY 203
Fly 204 YATISASID 212 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CG10126 | NP_788664.2 | EF-hand_7 | 62..119 | CDD:290234 | 15/57 (26%) |
EFh | 64..119 | CDD:238008 | 15/55 (27%) | ||
EFh | 97..154 | CDD:238008 | 14/59 (24%) | ||
EF-hand_7 | 98..158 | CDD:290234 | 15/62 (24%) | ||
EF-hand_7 | 134..204 | CDD:290234 | 13/69 (19%) | ||
CDPK19 | NP_197446.1 | STKc_CAMK | 57..314 | CDD:270687 | |
FRQ1 | 354..501 | CDD:227455 | 34/162 (21%) | ||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_KOG0032 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.900 |