DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10126 and CPK34

DIOPT Version :9

Sequence 1:NP_788664.2 Gene:CG10126 / 41579 FlyBaseID:FBgn0038088 Length:227 Species:Drosophila melanogaster
Sequence 2:NP_197437.1 Gene:CPK34 / 832056 AraportID:AT5G19360 Length:523 Species:Arabidopsis thaliana


Alignment Length:163 Identity:49/163 - (30%)
Similarity:80/163 - (49%) Gaps:27/163 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    47 LRLL--CLSRGATGILGLGRAFRAMDDDGSKALNEEEFITGIRDTGLDVSEEEIKQMFATFDEDG 109
            ||::  |||.  ..|:||...|:.||.|.|..:..||...|:...|..:||.|::|:....|.||
plant   359 LRVIAGCLSE--EEIMGLKEMFKGMDTDNSGTITLEELRQGLAKQGTRLSEYEVQQLMEAADADG 421

  Fly   110 SGSINMTEFLLKLRPPMPQSRLNIIDQ------AFNKMDRDEDGVITIQDLKNVYSVKEHPKYQS 168
            :|:|:..||:      .....:|.:|:      ||...|:|..|.||.::|:.  :::|..  .:
plant   422 NGTIDYGEFI------AATMHINRLDREEHLYSAFQHFDKDNSGYITTEELEQ--ALREFG--MN 476

  Fly   169 GEKSEDEILTDFLHNFEGGRGNLDGKITREEFV 201
            ..:...||:::.       .|:.||:|..||||
plant   477 DGRDIKEIISEV-------DGDNDGRINYEEFV 502

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10126NP_788664.2 EF-hand_7 62..119 CDD:290234 20/56 (36%)
EFh 64..119 CDD:238008 19/54 (35%)
EFh 97..154 CDD:238008 18/62 (29%)
EF-hand_7 98..158 CDD:290234 18/65 (28%)
EF-hand_7 134..204 CDD:290234 20/74 (27%)
CPK34NP_197437.1 Pkinase 68..326 CDD:278497
STKc_CAMK 68..325 CDD:270687
PTZ00184 366..505 CDD:185504 46/156 (29%)
EFh 374..433 CDD:238008 21/64 (33%)
EFh 449..506 CDD:238008 19/65 (29%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0032
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.