DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10126 and CPK7

DIOPT Version :9

Sequence 1:NP_788664.2 Gene:CG10126 / 41579 FlyBaseID:FBgn0038088 Length:227 Species:Drosophila melanogaster
Sequence 2:NP_568281.1 Gene:CPK7 / 831123 AraportID:AT5G12480 Length:535 Species:Arabidopsis thaliana


Alignment Length:218 Identity:51/218 - (23%)
Similarity:95/218 - (43%) Gaps:46/218 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 WSL---KNPNCDL----------YTLEANMASQALRELTDGEDKDPITKLRLLCLSRGATGILGL 62
            |.|   |.||..|          :::...:..:|||.:.:.           |.:...|    |:
plant   316 WILNAKKAPNVSLGETVKARLKQFSVMNKLKKRALRVIAEH-----------LSVEEAA----GI 365

  Fly    63 GRAFRAMDDDGSKALNEEEFITGIRDTGLDVSEEEIKQMFATFDEDGSGSINMTEFL---LKLRP 124
            ..||..||.:....:|.||...|::..|..:::.:::.:....|.||.|::|.:||:   :.|:.
plant   366 KEAFEMMDVNKRGKINLEELKYGLQKAGQQIADTDLQILMEATDVDGDGTLNYSEFVAVSVHLKK 430

  Fly   125 PMPQSRLNIIDQAFNKMDRDEDGVITIQDLKNVYSVKEHPKYQSGEKSEDEILTDFLHNFEGGRG 189
            ......|:   :|||..|:::.|.|.|.:|      :|....:....|.:|::...:.:.:..: 
plant   431 MANDEHLH---KAFNFFDQNQSGYIEIDEL------REALNDELDNTSSEEVIAAIMQDVDTDK- 485

  Fly   190 NLDGKITREEFVNYYATISASID 212
              ||:|:.||||   |.:.|..|
plant   486 --DGRISYEEFV---AMMKAGTD 503

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10126NP_788664.2 EF-hand_7 62..119 CDD:290234 15/56 (27%)
EFh 64..119 CDD:238008 15/54 (28%)
EFh 97..154 CDD:238008 16/59 (27%)
EF-hand_7 98..158 CDD:290234 17/62 (27%)
EF-hand_7 134..204 CDD:290234 18/69 (26%)
CPK7NP_568281.1 STKc_CAMK 58..316 CDD:270687 51/218 (23%)
FRQ1 356..503 CDD:227455 41/176 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0032
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.