DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10126 and CPK17

DIOPT Version :9

Sequence 1:NP_788664.2 Gene:CG10126 / 41579 FlyBaseID:FBgn0038088 Length:227 Species:Drosophila melanogaster
Sequence 2:NP_196779.1 Gene:CPK17 / 831091 AraportID:AT5G12180 Length:528 Species:Arabidopsis thaliana


Alignment Length:163 Identity:48/163 - (29%)
Similarity:81/163 - (49%) Gaps:27/163 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    47 LRLL--CLSRGATGILGLGRAFRAMDDDGSKALNEEEFITGIRDTGLDVSEEEIKQMFATFDEDG 109
            ||::  |||.  ..|:||...|:.||.|.|..:..||...|:...|..:||.|::|:....|.||
plant   364 LRVIAGCLSE--EEIMGLKEMFKGMDTDSSGTITLEELRQGLAKQGTRLSEYEVQQLMEAADADG 426

  Fly   110 SGSINMTEFLLKLRPPMPQSRLNIIDQ------AFNKMDRDEDGVITIQDLKNVYSVKEHPKYQS 168
            :|:|:..||:      .....:|.:|:      ||...|:|..|.||:::|:.  :::|..  .:
plant   427 NGTIDYGEFI------AATMHINRLDREEHLYSAFQHFDKDNSGYITMEELEQ--ALREFG--MN 481

  Fly   169 GEKSEDEILTDFLHNFEGGRGNLDGKITREEFV 201
            ..:...||:::.       .|:.||:|..:|||
plant   482 DGRDIKEIISEV-------DGDNDGRINYDEFV 507

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10126NP_788664.2 EF-hand_7 62..119 CDD:290234 20/56 (36%)
EFh 64..119 CDD:238008 19/54 (35%)
EFh 97..154 CDD:238008 18/62 (29%)
EF-hand_7 98..158 CDD:290234 18/65 (28%)
EF-hand_7 134..204 CDD:290234 19/74 (26%)
CPK17NP_196779.1 STKc_CAMK 73..330 CDD:270687
PTZ00184 371..510 CDD:185504 45/156 (29%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0032
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.