DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10126 and CPK18

DIOPT Version :9

Sequence 1:NP_788664.2 Gene:CG10126 / 41579 FlyBaseID:FBgn0038088 Length:227 Species:Drosophila melanogaster
Sequence 2:NP_001190932.1 Gene:CPK18 / 829763 AraportID:AT4G36070 Length:561 Species:Arabidopsis thaliana


Alignment Length:183 Identity:41/183 - (22%)
Similarity:73/183 - (39%) Gaps:50/183 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    31 ALRELTDGEDKDPITKLRLLCLSRGATGILGLGRAFRAMDDDGSKALNEEEFITGI-RDTGLDVS 94
            |||.|....::|.:..||               ..|.|:|.|.:.:::.||....: :|....:.
plant   363 ALRALAKTINEDELDDLR---------------DQFDAIDIDKNGSISLEEMRQALAKDVPWKLK 412

  Fly    95 EEEIKQMFATFDEDGSGSINMTEFLLKLRPPMPQSRLNIIDQ------------AFNKMDRDEDG 147
            :..:.::....|.:..|.::.|||:      :....:|.:::            ||:|.|.|.||
plant   413 DARVAEILQANDSNTDGLVDFTEFV------VAALHVNQLEEHDSEKWQQRSRAAFDKFDIDGDG 471

  Fly   148 VITIQDLKNVYSVKEHPKYQSGEKSEDEILTDFLHNFEGGRGNLDGKITREEF 200
            .||.::|          :.|:|.|...|.|      .|....:.||:|:..||
plant   472 FITPEEL----------RLQTGLKGSIEPL------LEEADVDEDGRISINEF 508

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10126NP_788664.2 EF-hand_7 62..119 CDD:290234 11/57 (19%)
EFh 64..119 CDD:238008 11/55 (20%)
EFh 97..154 CDD:238008 15/68 (22%)
EF-hand_7 98..158 CDD:290234 16/71 (23%)
EF-hand_7 134..204 CDD:290234 21/79 (27%)
CPK18NP_001190932.1 STKc_CAMK 70..330 CDD:270687
S_TKc 71..331 CDD:214567
PTZ00184 367..514 CDD:185504 38/179 (21%)
EFh 378..437 CDD:238008 13/73 (18%)
EFh 459..513 CDD:238008 21/66 (32%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0032
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.