DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10126 and AT4G26470

DIOPT Version :9

Sequence 1:NP_788664.2 Gene:CG10126 / 41579 FlyBaseID:FBgn0038088 Length:227 Species:Drosophila melanogaster
Sequence 2:NP_001328595.1 Gene:AT4G26470 / 828753 AraportID:AT4G26470 Length:294 Species:Arabidopsis thaliana


Alignment Length:202 Identity:44/202 - (21%)
Similarity:78/202 - (38%) Gaps:54/202 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    43 PITKLRLLCL-------SRGAT----------------GILGLGRAFRAMDDDGSKALNEEEFIT 84
            |.|||....:       |||.|                |:......|:..|:|.:.:::..|...
plant    80 PETKLEAKIIEAVQRRASRGTTMKSFNSIVLKFPKIDDGLRNCKAIFQEFDEDSNGSIDHTELKN 144

  Fly    85 GIRDTGLDVSEEEIKQMFATFDEDGSGSINMTEFLLKL--------------------RPPMPQS 129
            .||...:...||||..:|...|.:....|..|||::.|                    .|.:..:
plant   145 CIRKLEISFDEEEINDLFKACDINEDMGITFTEFIVLLCLVYLLKDDSSTLQKKWTMGMPKLEPT 209

  Fly   130 RLNIIDQAFNKMDRDEDGVITIQDLKNVYSVKEHPKYQSGEKSEDEILTDFLHNFEGGRGNLDGK 194
            ...::| .|..:|.::||.::.:::  |.::.|     |||:|...|.   :..||....:.:|.
plant   210 FETLVD-TFVFLDENKDGYVSREEM--VRAIDE-----SGERSSGRIA---MKRFEEMDWDKNGM 263

  Fly   195 ITREEFV 201
            :..:||:
plant   264 VNFKEFL 270

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10126NP_788664.2 EF-hand_7 62..119 CDD:290234 15/56 (27%)
EFh 64..119 CDD:238008 15/54 (28%)
EFh 97..154 CDD:238008 15/76 (20%)
EF-hand_7 98..158 CDD:290234 14/79 (18%)
EF-hand_7 134..204 CDD:290234 17/68 (25%)
AT4G26470NP_001328595.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
10.960

Return to query results.
Submit another query.