DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10126 and CPK15

DIOPT Version :9

Sequence 1:NP_788664.2 Gene:CG10126 / 41579 FlyBaseID:FBgn0038088 Length:227 Species:Drosophila melanogaster
Sequence 2:NP_001190794.1 Gene:CPK15 / 828283 AraportID:AT4G21940 Length:561 Species:Arabidopsis thaliana


Alignment Length:200 Identity:59/200 - (29%)
Similarity:86/200 - (43%) Gaps:43/200 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    28 ASQALRE--LTDGEDKD-PI--------------TKLRLLCL-----SRGATGILGLGRAFRAMD 70
            |:|||..  :..||..| ||              .||:.|.|     |.....|.||...|..||
plant   351 AAQALEHPWIRGGEAPDKPIDSAVLSRMKQFRAMNKLKKLALKVIAESLSEEEIKGLKTMFANMD 415

  Fly    71 DDGSKALNEEEFITGIRDTGLDVSEEEIKQMFATFDEDGSGSINMTEFLLKLRPPMPQSRLNIID 135
            .|.|..:..||...|:...|..::|.|:||:....|.||:|:|:..||:..........|...:.
plant   416 TDKSGTITYEELKNGLAKLGSKLTEAEVKQLMEAADVDGNGTIDYIEFISATMHRYRFDRDEHVF 480

  Fly   136 QAFNKMDRDEDGVITIQDLKNVYSVKEHPKYQSGEKSE-----DEILTDFLHNFEGGRGNLDGKI 195
            :||...|:|..|.||:.:|::  ::||   |..|:::.     .|:.||           .||:|
plant   481 KAFQYFDKDNSGFITMDELES--AMKE---YGMGDEASIKEVIAEVDTD-----------NDGRI 529

  Fly   196 TREEF 200
            ..|||
plant   530 NYEEF 534

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10126NP_788664.2 EF-hand_7 62..119 CDD:290234 20/56 (36%)
EFh 64..119 CDD:238008 19/54 (35%)
EFh 97..154 CDD:238008 18/56 (32%)
EF-hand_7 98..158 CDD:290234 18/59 (31%)
EF-hand_7 134..204 CDD:290234 20/71 (28%)
CPK15NP_001190794.1 S_TKc 102..360 CDD:214567 4/8 (50%)
STKc_CAMK 102..359 CDD:270687 4/7 (57%)
PTZ00184 395..540 CDD:185504 45/155 (29%)
EFh 407..466 CDD:238008 21/58 (36%)
EFh 478..539 CDD:238008 20/72 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0032
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.