DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10126 and CAPS

DIOPT Version :9

Sequence 1:NP_788664.2 Gene:CG10126 / 41579 FlyBaseID:FBgn0038088 Length:227 Species:Drosophila melanogaster
Sequence 2:NP_004049.3 Gene:CAPS / 828 HGNCID:1487 Length:189 Species:Homo sapiens


Alignment Length:180 Identity:85/180 - (47%)
Similarity:121/180 - (67%) Gaps:2/180 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly    46 KLRLLCLSRGATGILGLGRAFRAMDDDGSKALNEEEFITGIRDTGLDVSEEEIKQMFATFDEDGS 110
            |||..||||||:||.||.|.||.:|.|||::|:.:||..|:...||.:.:.|.:.:...:|.:||
Human    10 KLRAQCLSRGASGIQGLARFFRQLDRDGSRSLDADEFRQGLAKLGLVLDQAEAEGVCRKWDRNGS 74

  Fly   111 GSINMTEFLLKLRPPMPQSRLNIIDQAFNKMDRDEDGVITIQDLKNVYSVKEHPKYQSGEKSEDE 175
            |::::.|||..|||||.|:|..:|..||.|:||..|||:|:.||:.|||.:.|||.:|||.:|||
Human    75 GTLDLEEFLRALRPPMSQAREAVIAAAFAKLDRSGDGVVTVDDLRGVYSGRAHPKVRSGEWTEDE 139

  Fly   176 ILTDFLHNFEGGRGNLDGKITREEFVNYYATISASIDNDMFFDLMMRRAY 225
            :|..||.||:.  ...||::|..||.:||:.:|||::.|..|..||..|:
Human   140 VLRRFLDNFDS--SEKDGQVTLAEFQDYYSGVSASMNTDEEFVAMMTSAW 187

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10126NP_788664.2 EF-hand_7 62..119 CDD:290234 20/56 (36%)
EFh 64..119 CDD:238008 19/54 (35%)
EFh 97..154 CDD:238008 25/56 (45%)
EF-hand_7 98..158 CDD:290234 26/59 (44%)
EF-hand_7 134..204 CDD:290234 34/69 (49%)
CAPSNP_004049.3 EFh_PI-PLC 26..165 CDD:333715 63/140 (45%)
EFh 26..87 CDD:238008 22/60 (37%)
EF-hand motif 26..54 CDD:320029 12/27 (44%)
EF-hand motif 61..89 CDD:320029 10/27 (37%)
EF-hand motif 94..131 CDD:320029 19/36 (53%)
EF-hand motif 139..165 CDD:320029 11/27 (41%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 82 1.000 Domainoid score I8408
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG56894
OrthoDB 1 1.010 - - D1377102at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - mtm8486
orthoMCL 1 0.900 - - OOG6_103375
Panther 1 1.100 - - O PTHR34524
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
76.930

Return to query results.
Submit another query.