DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10126 and CPK23

DIOPT Version :9

Sequence 1:NP_788664.2 Gene:CG10126 / 41579 FlyBaseID:FBgn0038088 Length:227 Species:Drosophila melanogaster
Sequence 2:NP_001190672.1 Gene:CPK23 / 825809 AraportID:AT4G04740 Length:533 Species:Arabidopsis thaliana


Alignment Length:145 Identity:43/145 - (29%)
Similarity:75/145 - (51%) Gaps:17/145 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    44 ITKLRLLCLSRGATG-----ILGLGRAFRAMDDDGSKALNEEEFITGIRDTGLDVSEEEIKQMFA 103
            :.||:.|.|...|..     |.||...|..||.:.|..:..|:..||:......:||.|::|:..
plant   351 MNKLKKLALKVSAVSLSEEEIKGLKTLFANMDTNRSGTITYEQLQTGLSRLRSRLSETEVQQLVE 415

  Fly   104 TFDEDGSGSINMTEFLLKLRPPMPQSRLN---IIDQAFNKMDRDEDGVITIQDLKNVYSVKEHPK 165
            ..|.||:|:|:..||   :...|.:.:|:   .:.:||..:|:|::|.||..:|::  ::||   
plant   416 ASDVDGNGTIDYYEF---ISATMHRYKLHHDEHVHKAFQHLDKDKNGHITRDELES--AMKE--- 472

  Fly   166 YQSG-EKSEDEILTD 179
            |..| |.|..|::::
plant   473 YGMGDEASIKEVISE 487

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10126NP_788664.2 EF-hand_7 62..119 CDD:290234 18/56 (32%)
EFh 64..119 CDD:238008 17/54 (31%)
EFh 97..154 CDD:238008 18/59 (31%)
EF-hand_7 98..158 CDD:290234 18/62 (29%)
EF-hand_7 134..204 CDD:290234 15/47 (32%)
CPK23NP_001190672.1 STKc_CAMK 82..326 CDD:270687
S_TKc 84..327 CDD:214567
EF-hand_7 374..433 CDD:290234 19/61 (31%)
EFh 374..433 CDD:238008 19/61 (31%)
EFh 445..>492 CDD:238008 15/48 (31%)
EF-hand_7 446..>492 CDD:290234 15/47 (32%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0032
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.