DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10126 and CPK27

DIOPT Version :9

Sequence 1:NP_788664.2 Gene:CG10126 / 41579 FlyBaseID:FBgn0038088 Length:227 Species:Drosophila melanogaster
Sequence 2:NP_192379.2 Gene:CPK27 / 825805 AraportID:AT4G04700 Length:485 Species:Arabidopsis thaliana


Alignment Length:163 Identity:48/163 - (29%)
Similarity:77/163 - (47%) Gaps:11/163 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    47 LRLLCLSRGATGILGLGRAFRAMDDDGSKALNEEEFITGIRDTGLDVSEEEIKQMFATFDEDGSG 111
            |:.:..:.....|.||...|..:|.|.|..:..||..||:...|.::|:.|::|:....|.||:|
plant   322 LKFIAANLSEEEIKGLKTLFTNIDTDKSGNITLEELKTGLTRLGSNLSKTEVEQLMEAADMDGNG 386

  Fly   112 SINMTEFLLKLRPPMPQSRLNIIDQAFNKMDRDEDGVITIQDLKNVYSVKEHPKYQSGEKSEDEI 176
            :|::.||:..........|...:.:||...|:|.||.||.::|:  .::||......|  |..:|
plant   387 TIDIDEFISATMHRYKLDRDEHVYKAFQHFDKDNDGHITKEELE--MAMKEDGAGDEG--SIKQI 447

  Fly   177 LTDFLHNFEGGRGNLDGKITREEFVNYYATISA 209
            :.|       ...:.||||..|||.....|.|:
plant   448 IAD-------ADTDNDGKINFEEFRTMMRTESS 473

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10126NP_788664.2 EF-hand_7 62..119 CDD:290234 19/56 (34%)
EFh 64..119 CDD:238008 18/54 (33%)
EFh 97..154 CDD:238008 18/56 (32%)
EF-hand_7 98..158 CDD:290234 18/59 (31%)
EF-hand_7 134..204 CDD:290234 22/69 (32%)
CPK27NP_192379.2 S_TKc 28..290 CDD:214567
STKc_CAMK 28..289 CDD:270687
PTZ00184 325..468 CDD:185504 45/153 (29%)
EFh 337..396 CDD:238008 20/58 (34%)
EFh 411..469 CDD:238008 22/68 (32%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0032
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.