Sequence 1: | NP_788664.2 | Gene: | CG10126 / 41579 | FlyBaseID: | FBgn0038088 | Length: | 227 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_190753.2 | Gene: | CPK13 / 824348 | AraportID: | AT3G51850 | Length: | 528 | Species: | Arabidopsis thaliana |
Alignment Length: | 200 | Identity: | 45/200 - (22%) |
---|---|---|---|
Similarity: | 84/200 - (42%) | Gaps: | 41/200 - (20%) |
- Green bases have known domain annotations that are detailed below.
Fly 14 KNPNCDL----------YTLEANMASQALRELTDGEDKDPITKLRLLCLSRGATGILGLGRAFRA 68
Fly 69 MDDDGSKALNEEEFITGIRDTGLDVSEEEIKQMFATFDEDGSGSINMTEFL---LKLRPPMPQSR 130
Fly 131 LNIIDQAFNKMDRDEDGVITIQDLKNVYSVKEHPKYQSGEKSEDEILTDFLHNFEGGRGNLDGKI 195
Fly 196 TREEF 200 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CG10126 | NP_788664.2 | EF-hand_7 | 62..119 | CDD:290234 | 15/56 (27%) |
EFh | 64..119 | CDD:238008 | 15/54 (28%) | ||
EFh | 97..154 | CDD:238008 | 16/59 (27%) | ||
EF-hand_7 | 98..158 | CDD:290234 | 16/62 (26%) | ||
EF-hand_7 | 134..204 | CDD:290234 | 18/66 (27%) | ||
CPK13 | NP_190753.2 | STKc_CAMK | 53..311 | CDD:270687 | |
FRQ1 | 352..493 | CDD:227455 | 37/164 (23%) | ||
EFh_PEF | 470..>526 | CDD:355382 | 6/21 (29%) | ||
EF-hand motif | 470..497 | CDD:320054 | 6/21 (29%) | ||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_KOG0032 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
2 | 1.810 |