DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10126 and CPK13

DIOPT Version :9

Sequence 1:NP_788664.2 Gene:CG10126 / 41579 FlyBaseID:FBgn0038088 Length:227 Species:Drosophila melanogaster
Sequence 2:NP_190753.2 Gene:CPK13 / 824348 AraportID:AT3G51850 Length:528 Species:Arabidopsis thaliana


Alignment Length:200 Identity:45/200 - (22%)
Similarity:84/200 - (42%) Gaps:41/200 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    14 KNPNCDL----------YTLEANMASQALRELTDGEDKDPITKLRLLCLSRGATGILGLGRAFRA 68
            |.||..|          :::......:|||.:.:....:.:..::::               |..
plant   317 KAPNVPLGDVVKSRLKQFSVMNRFKRKALRVIAEFLSTEEVEDIKVM---------------FNK 366

  Fly    69 MDDDGSKALNEEEFITGIRDTGLDVSEEEIKQMFATFDEDGSGSINMTEFL---LKLRPPMPQSR 130
            ||.|....::.||...|:||....::|.|::.:....|..|.|:::..||:   |.|:.......
plant   367 MDTDNDGIVSIEELKAGLRDFSTQLAESEVQMLIEAVDTKGKGTLDYGEFVAVSLHLQKVANDEH 431

  Fly   131 LNIIDQAFNKMDRDEDGVITIQDLKNVYSVKEHPKYQSGEKSEDEILTDFLHNFEGGRGNLDGKI 195
            |.   :||:..|:|.:|.|..|:|.:  ::||    ..|:...| :..|.....:..:   ||:|
plant   432 LR---KAFSYFDKDGNGYILPQELCD--ALKE----DGGDDCVD-VANDIFQEVDTDK---DGRI 483

  Fly   196 TREEF 200
            :.|||
plant   484 SYEEF 488

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10126NP_788664.2 EF-hand_7 62..119 CDD:290234 15/56 (27%)
EFh 64..119 CDD:238008 15/54 (28%)
EFh 97..154 CDD:238008 16/59 (27%)
EF-hand_7 98..158 CDD:290234 16/62 (26%)
EF-hand_7 134..204 CDD:290234 18/66 (27%)
CPK13NP_190753.2 STKc_CAMK 53..311 CDD:270687
FRQ1 352..493 CDD:227455 37/164 (23%)
EFh_PEF 470..>526 CDD:355382 6/21 (29%)
EF-hand motif 470..497 CDD:320054 6/21 (29%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0032
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.