DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10126 and CRK

DIOPT Version :9

Sequence 1:NP_788664.2 Gene:CG10126 / 41579 FlyBaseID:FBgn0038088 Length:227 Species:Drosophila melanogaster
Sequence 2:NP_001190048.1 Gene:CRK / 824217 AraportID:AT3G50530 Length:632 Species:Arabidopsis thaliana


Alignment Length:215 Identity:45/215 - (20%)
Similarity:85/215 - (39%) Gaps:53/215 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    28 ASQALRE--LTDGEDKDPITKLRLLCLSRGATGILGLGR-AFRAMDDDGSKALNEEEFITGIRDT 89
            |:|||..  :.|..|......:.:..|.|.......|.: |.||:    ||.|..:|..      
plant   432 AAQALSHPWIKDSNDAKVPMDILVFKLMRAYLRSSSLRKAALRAL----SKTLTVDELF------ 486

  Fly    90 GLDVSEEEIKQMFATFDEDGSGSI---NMTEFLLKL-RPPMPQSRL-NIIDQ----AFNKMDRDE 145
                   .:::.||..:...:|:|   |:...|:|: ...|..||: ..:.|    .:.:||.:|
plant   487 -------YLREQFALLEPSKNGTISLENIKSALMKMATDAMKDSRIPEFLGQLSALQYRRMDFEE 544

  Fly   146 --DGVITIQDLKNVYSVKEHPK--YQSGEKSE------DEILTDF-----------LHNFEGGRG 189
              ...:::..|:.:...::|.:  |:..||..      ||:.::.           ||::   ..
plant   545 FCAAALSVHQLEALDRWEQHARCAYELFEKEGNRPIMIDELASELGLGPSVPVHAVLHDW---LR 606

  Fly   190 NLDGKITREEFVNYYATISA 209
            :.|||::...||.....:|:
plant   607 HTDGKLSFLGFVKLLHGVSS 626

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10126NP_788664.2 EF-hand_7 62..119 CDD:290234 13/60 (22%)
EFh 64..119 CDD:238008 12/58 (21%)
EFh 97..154 CDD:238008 14/67 (21%)
EF-hand_7 98..158 CDD:290234 15/70 (21%)
EF-hand_7 134..204 CDD:290234 18/94 (19%)
CRKNP_001190048.1 STKc_CAMK 147..440 CDD:270687 4/7 (57%)
S_TKc 148..441 CDD:214567 4/8 (50%)
Glo_EDI_BRP_like 526..>597 CDD:301325 11/70 (16%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0032
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.