DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10126 and CAM7

DIOPT Version :9

Sequence 1:NP_788664.2 Gene:CG10126 / 41579 FlyBaseID:FBgn0038088 Length:227 Species:Drosophila melanogaster
Sequence 2:NP_001326523.1 Gene:CAM7 / 823492 AraportID:AT3G43810 Length:214 Species:Arabidopsis thaliana


Alignment Length:178 Identity:51/178 - (28%)
Similarity:80/178 - (44%) Gaps:38/178 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    27 MASQALRELTDGEDKDPITKLRLLCLSRGATGILGLGRAFRAMDDDGSKALNEEEFITGIRDTGL 91
            ||.|    |||    |.|::.:               .||...|.||...:..:|..|.:|..|.
plant     1 MADQ----LTD----DQISEFK---------------EAFSLFDKDGDGCITTKELGTVMRSLGQ 42

  Fly    92 DVSEEEIKQMFATFDEDGSGSINMTEFL-LKLRPPMPQSRLNIIDQAFNKMDRDEDGVITIQDLK 155
            :.:|.|::.|....|.||:|:|:..||| |..|..........:.:||...|:|::|.|:..:|:
plant    43 NPTEAELQDMINEVDADGNGTIDFPEFLNLMARKMKDTDSEEELKEAFRVFDKDQNGFISAAELR 107

  Fly   156 NVYSVKEHPKYQSGEKSEDEILTDFLH--NFEGGRGNLDGKITREEFV 201
            :|.:       ..|||..||.:.:.:.  :.:|     ||:|..||||
plant   108 HVMT-------NLGEKLTDEEVDEMIREADVDG-----DGQINYEEFV 143

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10126NP_788664.2 EF-hand_7 62..119 CDD:290234 18/56 (32%)
EFh 64..119 CDD:238008 18/54 (33%)
EFh 97..154 CDD:238008 18/57 (32%)
EF-hand_7 98..158 CDD:290234 18/60 (30%)
EF-hand_7 134..204 CDD:290234 21/70 (30%)
CAM7NP_001326523.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.