DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10126 and AT3G24110

DIOPT Version :9

Sequence 1:NP_788664.2 Gene:CG10126 / 41579 FlyBaseID:FBgn0038088 Length:227 Species:Drosophila melanogaster
Sequence 2:NP_001319629.1 Gene:AT3G24110 / 821997 AraportID:AT3G24110 Length:232 Species:Arabidopsis thaliana


Alignment Length:164 Identity:35/164 - (21%)
Similarity:71/164 - (43%) Gaps:27/164 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    58 GILGLGRAFRAMDDDGSKALNEEEFITGIRDTGLDVSEEEIKQMFATFDEDGSGSINMTEFLL-- 120
            |:..:...|.:.|:|.:..::.||....:.:..|.:|:||:|.:::..|.|||..|...||::  
plant    57 GLRNIRSVFESYDNDTNGTIDIEELKKCLEELKLSLSDEEVKGLYSWCDVDGSKGIQFNEFIVLL 121

  Fly   121 ------------------KLRPPMPQSRLNIIDQAFNKMDRDEDGVITIQDLKNVYSVKEHPKYQ 167
                              ::.|.:.:|..:.|.:.|..:|:|..|.:...|:....:.:::|.  
plant   122 CLIYLLAKPSSESSTESREMGPKLVESIFDPIVEVFLFLDKDGKGKLNKADVIKTLNNEDYPL-- 184

  Fly   168 SGEKSEDEILTDFLHNFEGGRGNLDGKITREEFV 201
              |:|...:........:.||   .||:...||:
plant   185 --ERSPSHVTNMRFEEMDWGR---KGKVGFREFL 213

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10126NP_788664.2 EF-hand_7 62..119 CDD:290234 16/56 (29%)
EFh 64..119 CDD:238008 16/54 (30%)
EFh 97..154 CDD:238008 16/76 (21%)
EF-hand_7 98..158 CDD:290234 16/79 (20%)
EF-hand_7 134..204 CDD:290234 15/68 (22%)
AT3G24110NP_001319629.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
00.000

Return to query results.
Submit another query.