DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10126 and AT3G19100

DIOPT Version :9

Sequence 1:NP_788664.2 Gene:CG10126 / 41579 FlyBaseID:FBgn0038088 Length:227 Species:Drosophila melanogaster
Sequence 2:NP_188541.1 Gene:AT3G19100 / 821445 AraportID:AT3G19100 Length:599 Species:Arabidopsis thaliana


Alignment Length:204 Identity:37/204 - (18%)
Similarity:76/204 - (37%) Gaps:56/204 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    21 YTLEANMASQALRELTDGEDKDPI--TKLRLLCLSRGATGILGLGRAFRAMDDDGSKALNEEE-- 81
            |...:::...||..|:.....|.:  .|.:...|:....|::.|.....|:..:.::|:.|..  
plant   427 YLRSSSLRKAALMALSKTLTTDELLYLKAQFAHLAPNKNGLITLDSIRLALATNATEAMKESRIP 491

  Fly    82 ----FITGIRDTGLDVSEEEIKQMFATFDEDGSGSINMTEFLLKLRPPMPQSRLNIIDQ----AF 138
                .:.|::..|:|            |:|..:.||::.:          ...|:..:|    |:
plant   492 DFLALLNGLQYKGMD------------FEEFCAASISVHQ----------HESLDCWEQSIRHAY 534

  Fly   139 NKMDRDEDGVITIQDLKNVY----SVKEHPKYQSGEKSEDEILTDFLHNFEGGRGNLDGKITREE 199
            ...:.:.:.||.|::|.:..    |:..|           .||.|::.       :.|||::...
plant   535 ELFEMNGNRVIVIEELASELGVGSSIPVH-----------TILNDWIR-------HTDGKLSFLG 581

  Fly   200 FVNYYATIS 208
            ||.....:|
plant   582 FVKLLHGVS 590

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10126NP_788664.2 EF-hand_7 62..119 CDD:290234 11/62 (18%)
EFh 64..119 CDD:238008 10/60 (17%)
EFh 97..154 CDD:238008 10/60 (17%)
EF-hand_7 98..158 CDD:290234 11/63 (17%)
EF-hand_7 134..204 CDD:290234 16/77 (21%)
AT3G19100NP_188541.1 STKc_CAMK 145..405 CDD:270687
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0032
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.